KEGG   Geobacter lovleyi: Glov_1618Help
Entry
Glov_1618         CDS       T00708                                 

Definition
(GenBank) Triose-phosphate isomerase
  KO
K01803  triosephosphate isomerase (TIM) [EC:5.3.1.1]
Organism
glo  Geobacter lovleyi
Pathway
glo00010  Glycolysis / Gluconeogenesis
glo00051  Fructose and mannose metabolism
glo00562  Inositol phosphate metabolism
glo01100  Metabolic pathways
glo01110  Biosynthesis of secondary metabolites
glo01120  Microbial metabolism in diverse environments
glo01130  Biosynthesis of antibiotics
glo01200  Carbon metabolism
glo01230  Biosynthesis of amino acids
Module
glo_M00001  Glycolysis (Embden-Meyerhof pathway), glucose => pyruvate
glo_M00002  Glycolysis, core module involving three-carbon compounds
glo_M00003  Gluconeogenesis, oxaloacetate => fructose-6P
Brite
KEGG Orthology (KO) [BR:glo00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    Glov_1618
   00051 Fructose and mannose metabolism
    Glov_1618
   00562 Inositol phosphate metabolism
    Glov_1618
Enzymes [BR:glo01000]
 5. Isomerases
  5.3  Intramolecular oxidoreductases
   5.3.1  Interconverting aldoses and ketoses, and related compounds
    5.3.1.1  triose-phosphate isomerase
     Glov_1618
Exosome [BR:glo04147]
 Exosomal proteins
  Exosomal proteins of colorectal cancer cells
   Glov_1618
  Exosomal proteins of bladder cancer cells
   Glov_1618
  Exosomal proteins of melanoma cells
   Glov_1618
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: TIM
Motif
Other DBs
NCBI-ProteinID: ACD95334
JGI: Glov1618
UniProt: B3E9Q8
Position
1721400..1722155
Genome map
AA seq 251 aa AA seqDB search
MRTPLIAGNWKLFKTLADATALIDELVPLVSDVKDVEIVVAPVFTAINTVAKAAGKTGVK
VAAQDCYWEDEGAFTGEVSPKLLKDAGCSHVIIGHSERRQYFGETDGTVNLKTKAAIRAG
LTVLLCVGESLAQRESNDTFKVIETQVRGGLADIPAAELTQIVVAYEPVWAIGTGKTASD
AQAQEVHAFIRTLVAQIYGPSEADAMRILYGGSVKPENIKGLMSQPDIDGALVGGASLKA
ESFAGIVRFKG
NT seq 756 nt NT seq  +upstreamnt  +downstreamnt
atgcgtacaccgcttattgctggaaactggaagctgtttaagacgctggctgatgcaacg
gccctgattgatgagctggtgcccctggttagcgatgtcaaggacgttgagatagttgtt
gcgccggtatttactgcgattaatacggtagcaaaggccgctggaaaaactggtgtcaag
gtggcggcacaggattgttactgggaggatgaaggggccttcaccggcgaggtttcgcca
aaactgttgaaggatgctggctgtagccatgtcatcattggccattctgagcgccggcag
tattttggcgaaacagatggcaccgtcaacctcaaaacaaaagccgctattagggctgga
ctgacagtactgctgtgtgttggcgagagtcttgcccagcgtgaatcaaacgataccttc
aaagtgattgagactcaggtccgaggggggctggctgatatccctgcagctgagctgacg
cagatcgttgtagcttatgaaccagtctgggcgattggcactggcaaaactgccagtgat
gcgcaggcacaggaggtgcacgcctttattcggacgctggtcgctcagatctatggccct
tcagaggctgacgcaatgcgtattctctatggcggaagtgtaaagccggagaatatcaaa
ggtttgatgtcacaaccagatattgatggtgcattggttggtggagcaagccttaaagct
gaatcatttgcaggtattgttcgatttaagggctga

DBGET integrated database retrieval system