KEGG   Geobacter lovleyi: Glov_1943Help
Entry
Glov_1943         CDS       T00708                                 

Definition
(GenBank) peptidase M42 family protein
Organism
glo  Geobacter lovleyi
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
JGI: 
UniProt: 
Position
complement(2066629..2067699)
Genome map
AA seq 356 aa AA seqDB search
MRKESLVFLEKLLAAPSPSGYEQPAQRLFRDYVAPYCQVSSDVLGNVYGFIAGQGKDCPK
VMLVGHSDEIGLQVKYIDDKGFLYFAAIGGVDAHLTPGKVVHIHTTDGPLPGVVGKRPIH
LMDTKDRETVVKLEAQYIDIGAKDKKEAQKLVRVGDCITFESGFTHLQGDRVASRGFDDK
AGSFVVAEVLRLVAAEKKKLPVDLYGVSSVQEEIGLRGGTTSCYTINPDIGICVEVDFAT
DQPDVERKHNGEVALGKGPILTRGANINHALFELLYATAQKDKIAVQLTANPRATGTDAN
VMQISRGGVATALVKLPLRYMHTPVEVVSLGDLEQAAKLIVATLKMITDRGTFVPQ
NT seq 1071 nt NT seq  +upstreamnt  +downstreamnt
atgcgcaaggaatcactggtttttctggaaaagctgctggccgcccccagcccctctggc
tatgaacagcccgcccagcgactgtttcgtgactacgttgctccctactgtcaggtcagc
agtgatgtactgggtaatgtctacggctttattgcaggtcagggcaaggattgtcccaag
gtgatgctggtggggcattccgatgaaatcggcctgcaggtcaaatacatcgatgacaag
gggtttctctattttgccgccattggcggggttgatgcacatttaacaccgggcaaggtt
gtccatatccatacgacagacggcccacttcccggtgttgtcggcaagcgcccgattcac
ttgatggataccaaagatcgcgaaaccgtggtcaagctggaggcccagtacattgatatc
ggggcaaaagacaagaaagaggcccaaaaactggtgcgggtaggggattgcatcaccttt
gagagcggctttacccacttgcagggcgaccgggttgcatcccgtggctttgatgacaag
gccggttcctttgtggtggcagaagtgttgcgcctggtggctgcagaaaagaaaaagctg
ccggttgatttgtacggcgtgtcatcggtacaggaagagatcggcctacgtggcggcacc
accagctgttataccatcaacccggatatcggcatctgcgttgaagtggattttgccaca
gaccagcctgatgttgagcggaaacacaatggtgaggtggccttgggtaaaggtccgatc
ctgacccgcggagccaatatcaaccatgccctgtttgaattgctgtacgccacagcccag
aaggacaagatcgccgtacaattaaccgccaatccccgtgcaaccggcaccgatgccaat
gtaatgcagatttcccggggcggggtagctactgccttggtaaaactaccgttacgctat
atgcatacaccggtagaggtggtttcattgggagatctggagcaggcggccaagctgatt
gtggcgacgctgaagatgattaccgaccgtggaacgtttgtaccgcaataa

DBGET integrated database retrieval system