KEGG   Geobacter lovleyi: Glov_2041Help
Entry
Glov_2041         CDS       T00708                                 

Definition
4-alpha-glucanotransferase (EC:2.4.1.25)
Orthology
K00705  
4-alpha-glucanotransferase [EC:2.4.1.25]
Organism
glo  Geobacter lovleyi
Pathway
Starch and sucrose metabolism
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:glo00001]
 Metabolism
  Carbohydrate metabolism
   00500 Starch and sucrose metabolism
    Glov_2041
Enzymes [BR:glo01000]
 2. Transferases
  2.4  Glycosyltransferases
   2.4.1  Hexosyltransferases
    2.4.1.25  4-alpha-glucanotransferase
     Glov_2041
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
2175122..2176603
Genome map
AA seq 493 aa AA seqDB search
MTVRRRAGVLLHPTSLPGPEGIGTFGTELTGFLDFLSKAGFSLWQVLPLTPPAAGNSPYS
SYSAFGGNHLLIDLQQLVEEGDLSSRALQNHFPQELVDFKQVTPWKEQLLHEAAENFFKQ
GQTPRLKEFWQFCDTTYWLHDYALFMALKQHYHGTPWHRWPNELAQRNPRALQQAALQLG
PEIGARKYQQWQFFRQWQRVRSAAAERGIAIIGDLPIFVAHDSADVWCNQELFLLDTKGK
STVVAGVPPDYFSATGQLWGNPLYNWAAMEQQGYGWWIARFRQLFELFDQIRIDHFRGFE
AAWHVPATAKTAARGSWVPGPGAVFFDAVKASLGNLSFIAEDLGVITPEVEALRDRYDLP
GMKILQFAFDSDAANPYLPHNHRTNSVVYTGTHDNDTTRGWFNTLSPKIINRMYDYLGLP
GTNPVQDLIRVALMSVAGTAIIPLQDLLELPTEARMNQPGVALGNWSWRYQSTQLKPGLA
DYYADLLRRYGRG
NT seq 1482 nt NT seq  +upstreamnt  +downstreamnt
atgactgtcaggagacgtgcaggcgtattgctgcatcccacatcactgcccggaccagaa
ggcatcggtacctttggaacagaactaaccggatttcttgactttctctcaaaagccggt
ttttcactctggcaggttctgccgttaaccccgcctgcagcaggaaactcgccctactcc
tcctattccgcctttggcggtaatcatctcttgatcgacctgcagcagctggtagaggaa
ggagatctctccagccgggcactacagaaccattttccacaggagctggttgatttcaaa
caggtgactccctggaaagagcaattgctgcacgaagccgcggaaaactttttcaaacag
gggcagacaccgcgtttgaaagagttctggcagttctgcgacacaacctactggctgcat
gactatgcgctgttcatggccttaaagcagcattaccacggcaccccctggcaccgctgg
cccaatgaactggcacaacgcaacccgcgggcacttcaacaggccgcccttcagcttgga
ccggaaatcggtgcccggaaatatcagcagtggcagttctttcgccaatggcaacgggtc
agaagcgcggcagcggaacggggtatagcgatcatcggcgacctgcctatttttgtggca
cacgactcagccgatgtctggtgcaaccaggagctgtttctgcttgatacaaagggaaaa
tcaacggtggttgccggggttccaccggattatttcagtgcaaccggtcagctctggggc
aatccgctctacaactgggcagccatggaacagcagggatatggctggtggatcgcccgt
tttcgtcagttatttgagctgtttgatcagatacgaatcgatcacttccgaggatttgag
gcggcctggcatgtgccggctacagccaagactgctgcccggggcagttgggtaccgggt
ccgggagccgttttttttgatgcagtaaaggcctcgcttggaaatctgtctttcatcgct
gaggatctgggagttatcacaccggaagttgaggcgttacgggatcgttatgacctgccc
ggcatgaaaatcctgcaatttgcctttgattccgatgcagccaacccttatctgccccac
aaccaccgcaccaacagcgttgtctacaccggtacccacgacaatgacaccaccagaggt
tggtttaataccctgtctcctaagatcatcaaccggatgtacgactatctcgggcttccc
ggcacaaacccggttcaggatctgatcagggtggccctgatgtcagtggccggaacggcg
atcataccgttgcaggatctgctggaactgccaacagaggctcgcatgaaccagcccggg
gttgcactgggcaactggagctggcgctatcagtcaacacagttaaagcccggattggct
gattactatgccgatctgttgaggcgttacggacggggataa

DBGET integrated database retrieval system