KEGG   Geobacter lovleyi: Glov_2157Help
Entry
Glov_2157         CDS       T00708                                 

Definition
thiol:disulfide interchange protein DsbC
Orthology
K03981  
thiol:disulfide interchange protein DsbC [EC:5.3.4.1]
Organism
glo  Geobacter lovleyi
Class
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
complement(2306104..2306901)
Genome map
AA seq 265 aa AA seqDB search
MIRTTLTTLSLVLLFAVSSFAMSPAKDGCGTQECSKCHSLSVKEATDLLSFAGVTVKSVK
PAPSHGMHEVLFQKDGGVGIVFIDYGKKHLIQGVIIDLKTKEPVAAHEKDIPKPKQFSGL
DPKLIPVQYAMVMGNPKAAKKLYVFTDPDCPYCRTLHPELQKLEKMMPDLAIHIMLYPLQ
QLHPQAYDKARTVLSTKSRKNLDLAFEGKELPKPKGDAGKAGVDAVIQFAQEQGINGTPM
VLLPNGKPYQGPRDAESIKKAIEGM
NT seq 798 nt NT seq  +upstreamnt  +downstreamnt
atgattcgcactacactgacgactctatcccttgtgctgctgtttgcggtctcttccttt
gccatgtcccccgccaaagatggctgcggtacccaagaatgctccaagtgccattctctg
tcagtaaaggaagcaactgacctgctcagctttgccggtgttacggttaaatcagtcaaa
ccggctcccagccacggtatgcacgaggtcctgttccaaaaagatggcggtgtagggatc
gtatttatcgattatggcaagaagcacctgattcagggggtaatcattgacctgaagacc
aaagagccggttgctgcccatgaaaaggatattcccaaaccaaagcagtttagcggcctt
gatcccaagctgatcccggtgcagtatgccatggtcatgggcaaccccaaggctgcaaag
aaactgtatgtctttaccgaccccgactgcccctactgccgtaccctgcacccggaacta
cagaaacttgaaaaaatgatgcctgatctggcgatccatatcatgctctaccccttgcag
cagctgcatccccaggcgtacgacaaggctcggacggtgctgtcgaccaagagccgcaag
aatcttgatcttgcctttgaaggcaaggaactacccaagcccaaaggggatgcaggcaag
gctggtgtggatgccgtgatacagtttgcccaggaacaggggatcaatggtaccccgatg
gtgttgctgccgaacggcaagccgtatcaggggcctcgggatgctgaaagtatcaagaag
gcaattgagggaatgtag

DBGET integrated database retrieval system