KEGG   Geobacter lovleyi: Glov_2234Help
Entry
Glov_2234         CDS       T00708                                 

Definition
(GenBank) hopanoid-associated sugar epimerase
  KO
K00091  dihydroflavonol-4-reductase [EC:1.1.1.219]
Organism
glo  Geobacter lovleyi
Brite
Enzymes [BR:glo01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.219  dihydroflavonol 4-reductase
     Glov_2234
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Epimerase 3Beta_HSD NAD_binding_10 NAD_binding_4 NmrA GDP_Man_Dehyd Polysacc_synt_2 adh_short RmlD_sub_bind KR TrkA_N
Motif
Other DBs
NCBI-ProteinID: ACD95950
JGI: Glov2234
UniProt: B3E4L4
Position
2384628..2385617
Genome map
AA seq 329 aa AA seqDB search
MKAFVTGATGFIGASIVRELLKDGHRVAALVRNGSDTANLQGLDVTILRGDLHDQQQLEQ
GMAGCDWAFHAAADYRLWCPEPQAMYHANVDGTRTLLAAALASGVTRVVYTSSVGTLGNP
GNGTPGTEETPVSLTDMVGDYKKSKFLAEREAEKFVDKGLGLIIVNPSTPVGPFDIKPTP
TGKIIVDFLNRKMPAYLDTGLNLIAVEDCARGHILAAEKGRIGQKYILGNRDLTLRDIFG
MLEQLTGLAAPRVRLPYTPILLAAYVNEAVSRLTGREPLIPLAGVQMAKKFMFFDASKAV
HELGLPQTPVEEALKRAVDWFRFNGYASA
NT seq 990 nt NT seq  +upstreamnt  +downstreamnt
atgaaggcttttgtcaccggcgccaccggctttatcggcgccagtatagtgcgggaactg
ttgaaggatggccacagagttgcggcactggtcaggaacggatctgataccgccaacctt
caggggcttgacgtcaccatcctgcggggtgatctgcatgaccaacagcagcttgagcag
ggcatggccggctgcgattgggcctttcatgctgctgccgattaccggctctggtgtcct
gaaccacaagccatgtaccatgccaatgtggatggcacccgtaccctgttggctgcagca
cttgctagcggtgtgacacgggtggtgtacaccagcagtgtcggcaccctgggcaacccc
ggcaatggcacgccaggcacggaagagacaccggtcagcctgaccgacatggtgggagac
tataaaaagagtaagtttctggcagagcgggaagcggaaaaattcgttgacaagggtctt
ggcctgattatagtcaacccttccaccccggtggggccgtttgacatcaaaccaacccct
accggcaagatcattgtggattttttgaaccgcaagatgccggcctaccttgataccggc
ctgaatctgatcgccgtggaagactgcgcccgaggccatatcctggcagcggaaaaagga
cggatcggccagaaatacatccttggcaaccgggatctcaccctgcgggatatcttcggc
atgcttgagcagctgaccggccttgcagcccccagggtgcgtctgccctacacgccgatc
ctgctggctgcctatgtaaacgaggcagtttcacggctgaccggcagagaaccgctgatt
ccgttggccggtgtccagatggcaaagaaattcatgtttttcgatgcatccaaggcagtg
catgaactggggcttccccagactccggtagaagaggcacttaagcgggctgttgactgg
ttccgtttcaatggctatgcctctgcataa

DBGET integrated database retrieval system