KEGG   Geobacter lovleyi: Glov_2280Help
Entry
Glov_2280         CDS       T00708                                 

Definition
threonine synthase (EC:4.2.3.1)
Orthology
K01733  
threonine synthase [EC:4.2.3.1]
Organism
glo  Geobacter lovleyi
Pathway
Glycine, serine and threonine metabolism
Vitamin B6 metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Biosynthesis of amino acids
Brite
KEGG Orthology (KO) [BR:glo00001]
 Metabolism
  Overview
   01230 Biosynthesis of amino acids
    Glov_2280
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    Glov_2280
  Metabolism of cofactors and vitamins
   00750 Vitamin B6 metabolism
    Glov_2280
Enzymes [BR:glo01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.3  Acting on phosphates
    4.2.3.1  threonine synthase
     Glov_2280
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
complement(2441660..2443042)
Genome map
AA seq 460 aa AA seqDB search
MRYLSTRGGIAPVRFKDAVMMGLADDGGLLLPESIPAFSAAELESWRTLTYPQLAFKIIS
RFVDDIPATDLQALIDRSYATFSHPEVTPVVQKDGVYILELFHGVTLAFKDVALQFLGNL
FEYILHERHERLTIVGATSGDTGSAAIHGVRGKAGISIFILHPHGKTSPVQALQMTSVLD
ENVHNIAVDGTFDDCQDIVKGLMGDLEFKQKYSLGAVNSINWARVLAQVVYYIYAWLRVA
EQGRKVVFSVPTGNFGDIFAGYMAQQMGLPVEKLLLATNENNILTRFINQGDYSVGTVVQ
TLSPSMDIQVASNFERYLFYLFKQDAARVSAAFAQLKAEGKISFSQQELQQVRQDFRSAS
VDRQATLETIRQFKHDTGYLLDPHTAVGVRAAQELVTDDTPVVCLATAHPAKFGEAVVEA
TGDAVPVPPAIAQLEGLPTRCVRMQADAGQVRAFIILTVG
NT seq 1383 nt NT seq  +upstreamnt  +downstreamnt
atgcgttacctgagtacccgtggcggcattgcgccggtacgttttaaagatgcggttatg
atggggttggccgacgatggcggccttctgttgccggagtcgattcctgctttttctgct
gcagaactggagtcatggcgcacactgacctatccgcagcttgcattcaagattatttca
cgttttgttgacgatatacctgcaacggaccttcaggccctgatagatcgttcctatgcc
accttcagccatccggaggtgaccccggtcgtacagaaggacggcgtctatatcctggag
ctgttccatggcgtcaccctggcctttaaagatgttgcactgcagttcctgggcaacctg
tttgagtatatcctgcatgaacggcatgagcgcctgaccattgtgggggccacctcaggt
gataccggcagtgcggccattcatggcgtgcggggcaaggccggcatcagcatctttatc
ctgcatccccatggtaagacctcgccggtacaggcgctgcagatgacgtcggtactggat
gaaaacgtccacaatatcgccgtggatggaacctttgatgactgtcaggatattgtcaag
gggctgatgggagaccttgagtttaagcagaaatactcgcttggagcggtaaattcaatc
aactgggcccgggtactggcccaggtggtgtactatatctatgcctggttacgggtggct
gagcagggtcggaaggtggtgttttcggttcccaccggaaatttcggggatatctttgcc
ggctatatggctcagcagatggggctgccggttgagaaactgctgctggcaaccaatgag
aacaatatcctgacccgtttcatcaatcagggggattattcggtcggtacggtggtgcaa
accttgtcgccatccatggatattcaggtcgcctccaactttgagcgctacctcttttat
ctctttaaacaggatgctgcccgggtttctgccgcctttgcccagctcaaggccgagggg
aaaatcagcttcagccagcaggaactgcaacaggtccgtcaggatttccggtctgcctcg
gttgatcgccaggcgaccctggagacgatcaggcagtttaagcatgataccggctatctg
ttggatcctcacaccgcggtaggggtgcgggcggcacaggagctggttacggatgatacg
ccggtggtctgtctggccacggcccatccggcaaagttcggtgaagcggtggttgaggcc
accggtgacgcggtaccggttcccccggccattgcccaactggaagggctgccgacccgt
tgtgtgcggatgcaggcagatgccgggcaggtgcgtgcatttattattttaacagtgggg
tag

DBGET integrated database retrieval system