KEGG   Geobacter lovleyi: Glov_2286Help
Entry
Glov_2286         CDS       T00708                                 

Gene name
gmk
Definition
guanylate kinase (EC:2.7.4.8)
Orthology
K00942  
guanylate kinase [EC:2.7.4.8]
Organism
glo  Geobacter lovleyi
Pathway
Purine metabolism
Metabolic pathways
Module
Guanine ribonucleotide biosynthesis IMP => GDP,GTP
Class
Metabolism; Nucleotide metabolism; Purine metabolism [PATH:glo00230]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
complement(2447064..2447672)
Genome map
AA seq 202 aa AA seqDB search
MQQEGLLIVISAPSGAGKTTLCNGLVSRFPALKESVSYTTRQPRPGEQDGVDYHFVSIER
FKQMIAENGFAEWAEVHGNFYGTAIATLEQARIDGIDILLDIDCQGARILKDRGINGLFV
FVLPPSMAELRRRLESRSSDAREVIERRIERATEEIREARWYDYIVVNDRLDEAHEALAS
LVTAARHTTARMLGQVSKMFDL
NT seq 609 nt NT seq  +upstreamnt  +downstreamnt
atgcagcaagaagggcttctaatcgttatttcagcaccgtccggggccggcaagacaaca
ctctgcaacggtctggtcagccgctttcctgcactgaaagagtcggtcagttatacgacc
cggcagcccaggccgggggaacaggatggggttgattaccattttgtctcgattgagcgt
ttcaagcagatgattgctgaaaacggttttgccgagtgggccgaggtgcatggtaatttt
tacggcaccgccattgcgacactggaacaggccaggattgacggcattgatatcctgctt
gatattgactgccagggtgcgcgtatcctcaaggaccggggtattaacggcctgtttgtc
tttgtcttgccccccagcatggcagagctgcggcgccggcttgaatcccgttcgtctgat
gcacgggaggtgatcgagcgccggatcgagcgggcaaccgaggagatccgtgaggcacgc
tggtatgactacatcgtggtaaacgaccggcttgatgaggcccacgaggcgctggcgtca
ctggtgactgccgcacgccataccacggcacgtatgttggggcaggtgtcgaaaatgttt
gatctttga

DBGET integrated database retrieval system