KEGG   Geobacter lovleyi: Glov_2286Help
Entry
Glov_2286         CDS       T00708                                 

Definition
(GenBank) Guanylate kinase
  KO
K00942  guanylate kinase [EC:2.7.4.8]
Organism
glo  Geobacter lovleyi
Pathway
glo00230  Purine metabolism
glo01100  Metabolic pathways
Module
glo_M00050  Guanine ribonucleotide biosynthesis IMP => GDP,GTP
Brite
KEGG Orthology (KO) [BR:glo00001]
 Metabolism
  Nucleotide metabolism
   00230 Purine metabolism
    Glov_2286
Enzymes [BR:glo01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.4  Phosphotransferases with a phosphate group as acceptor
    2.7.4.8  guanylate kinase
     Glov_2286
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Guanylate_kin AAA_18 AAA_22 AAA_16 MMR_HSR1 AAA_33 Thymidylate_kin ABC_tran RsgA_GTPase T2SSE TsaE AAA_35 ATP_bind_1 AAA_23
Motif
Other DBs
NCBI-ProteinID: ACD96002
JGI: Glov2286
UniProt: B3E4R6
Position
complement(2447064..2447672)
Genome map
AA seq 202 aa AA seqDB search
MQQEGLLIVISAPSGAGKTTLCNGLVSRFPALKESVSYTTRQPRPGEQDGVDYHFVSIER
FKQMIAENGFAEWAEVHGNFYGTAIATLEQARIDGIDILLDIDCQGARILKDRGINGLFV
FVLPPSMAELRRRLESRSSDAREVIERRIERATEEIREARWYDYIVVNDRLDEAHEALAS
LVTAARHTTARMLGQVSKMFDL
NT seq 609 nt NT seq  +upstreamnt  +downstreamnt
atgcagcaagaagggcttctaatcgttatttcagcaccgtccggggccggcaagacaaca
ctctgcaacggtctggtcagccgctttcctgcactgaaagagtcggtcagttatacgacc
cggcagcccaggccgggggaacaggatggggttgattaccattttgtctcgattgagcgt
ttcaagcagatgattgctgaaaacggttttgccgagtgggccgaggtgcatggtaatttt
tacggcaccgccattgcgacactggaacaggccaggattgacggcattgatatcctgctt
gatattgactgccagggtgcgcgtatcctcaaggaccggggtattaacggcctgtttgtc
tttgtcttgccccccagcatggcagagctgcggcgccggcttgaatcccgttcgtctgat
gcacgggaggtgatcgagcgccggatcgagcgggcaaccgaggagatccgtgaggcacgc
tggtatgactacatcgtggtaaacgaccggcttgatgaggcccacgaggcgctggcgtca
ctggtgactgccgcacgccataccacggcacgtatgttggggcaggtgtcgaaaatgttt
gatctttga

DBGET integrated database retrieval system