KEGG   Geobacter lovleyi: Glov_2484Help
Entry
Glov_2484         CDS       T00708                                 

Definition
(GenBank) Indole-3-glycerol-phosphate synthase
  KO
K01609  indole-3-glycerol phosphate synthase [EC:4.1.1.48]
Organism
glo  Geobacter lovleyi
Pathway
glo00400  Phenylalanine, tyrosine and tryptophan biosynthesis
glo01100  Metabolic pathways
glo01110  Biosynthesis of secondary metabolites
glo01130  Biosynthesis of antibiotics
glo01230  Biosynthesis of amino acids
Module
glo_M00023  Tryptophan biosynthesis, chorismate => tryptophan
Brite
KEGG Orthology (KO) [BR:glo00001]
 Metabolism
  Amino acid metabolism
   00400 Phenylalanine, tyrosine and tryptophan biosynthesis
    Glov_2484
Enzymes [BR:glo01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.1  Carboxy-lyases
    4.1.1.48  indole-3-glycerol-phosphate synthase
     Glov_2484
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: IGPS
Motif
Other DBs
NCBI-ProteinID: ACD96198
JGI: Glov2484
UniProt: B3E5V7
Position
complement(2653973..2654773)
Genome map
AA seq 266 aa AA seqDB search
MSSPPDILKTIVAHKKEEVAAARLAASLDELKVRISDLEDTPRGFERHLREAVASDWTAI
IAEVKKGSPSKGVIREDFDPLEIAEIYQNNGATCLSVLTDEKFFLGHLRFLALIREQVGL
PMLRKDFIIDPFQVYEARAAGADAILLIASILEPQQIVDLAGIARSVHLDVLLEVHDEAE
MEVACSTDIGLIGVNNRNLRTFVTDLGTTERLARMLPAGRLLVAESGINNRADIERLQAG
GAGAFLVGESLMREEDIGAKLQELLS
NT seq 801 nt NT seq  +upstreamnt  +downstreamnt
atgagctctccccctgatatccttaaaaccattgttgcccataaaaaggaagaagtcgct
gcagcgcgtctggccgcctcgctggatgagctgaaggtcaggatctctgaccttgaagac
accccgcgtggttttgaacgccacctgcgggaggcggttgcctcagactggaccgccatc
attgccgaggtcaagaaaggctcccccagcaaaggggtcatccgcgaagactttgatccg
ctggagatcgccgagatctaccagaacaacggcgccacctgcctttccgtcctgaccgat
gaaaagttctttctggggcatctgcgctttctggccctgatccgcgaacaggtcggcctg
ccgatgctgcgtaaagacttcatcattgatccgtttcaggtctatgaggcacgcgctgcc
ggtgccgatgccatcctgctgatcgcctccatcctggaaccgcagcagatcgttgatctg
gccggtattgcccggtccgtgcatctggatgtcctgctggaggtgcatgatgaagcagag
atggaggttgcctgcagcaccgacatcggcctgatcggtgtcaacaaccgcaacctgcgc
acctttgttacggatctgggcaccactgaacggctggccagaatgctgcctgccggacgc
ctgctggtggctgaaagcggtatcaacaaccgggccgatattgaacggctgcaggcaggc
ggtgccggtgcctttctggttggtgaatccctgatgcgggaagaagatatcggcgcaaaa
ctacaagaactgctttcttag

DBGET integrated database retrieval system