KEGG   Geobacter lovleyi: Glov_2519Help
Entry
Glov_2519         CDS       T00708                                 

Definition
6-phosphofructokinase (EC:2.7.1.11)
Orthology
K00850  
6-phosphofructokinase 1 [EC:2.7.1.11]
Organism
glo  Geobacter lovleyi
Pathway
Glycolysis / Gluconeogenesis
Pentose phosphate pathway
Fructose and mannose metabolism
Galactose metabolism
Methane metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Carbon metabolism
Biosynthesis of amino acids
Module
Glycolysis (Embden-Meyerhof pathway), glucose => pyruvate
Brite
KEGG Orthology (KO) [BR:glo00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    Glov_2519
   01230 Biosynthesis of amino acids
    Glov_2519
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    Glov_2519
   00030 Pentose phosphate pathway
    Glov_2519
   00051 Fructose and mannose metabolism
    Glov_2519
   00052 Galactose metabolism
    Glov_2519
  Energy metabolism
   00680 Methane metabolism
    Glov_2519
Enzymes [BR:glo01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.11  6-phosphofructokinase
     Glov_2519
Protein phosphatases and associated proteins [BR:glo01009]
 Protein Ser/ Thr phosphatases
  Phosphoprotein phosphatases (PPPs)
   Protein phosphatase-1
    PP1-interacting proteins (PIPs)
     Glov_2519
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
2693037..2693999
Genome map
AA seq 320 aa AA seqDB search
MKRLAILTSGGDCSGMNATIRAAARTAIANDVEMIGYRKGYAGLLKNEYIVLDSMAVSGT
LQRGGTFLQSARSQEFRTEEGRKKALDNLMKERVEGLIVVGGDGSLSGALALDKMGFPVI
GIPASIDNDIAYTDMALGVDTALNNIIYAVDCIKDTASSHDRAFIVEVMGRNSGYLASTA
AIATGAEFAIVPEVELDLTDMCHQLRRRYEEGRTNALIIMAEGAGHAQSIADGIKDAVGF
ETRVTVLGHYQRGGAPSVFDRLLGSRFGRKSVELLLSGTKGVMVGLSANSLTTTLLEMVV
KGGQKKLNEDLLRMADILGI
NT seq 963 nt NT seq  +upstreamnt  +downstreamnt
atgaagcgacttgccattctgaccagcggcggtgactgttccggcatgaacgccaccatc
cgggctgcggcccgcacggccattgccaatgatgttgagatgatcggctaccgcaagggc
tatgccgggctgctcaagaacgaatatatcgtgctggacagcatggcggtgtcaggcacg
ctgcagcggggcggcacctttctgcaatcagcccgttcccaggagttccgcaccgaagag
gggcgcaagaaggcgctggacaacctgatgaaggaacgggtggaaggtctgatcgtggtg
gggggtgacggttccctgtccggcgccctggccctggataagatgggctttccggtgatc
ggcattccggccagtattgacaatgacattgcctacaccgacatggcgctgggggtggat
acggccctgaacaatatcatttatgcggtggactgcatcaaggataccgcctcatcccat
gaccgggcctttattgttgaggtgatgggccgcaactccggctacctggcctccaccgcc
gccattgccaccggggccgagtttgcgattgtgcctgaggtggagctggacctgaccgac
atgtgccaccagttgcggcggcgctatgaggaggggcgcaccaatgccctgatcatcatg
gcggaaggggccggccatgcccagtccattgccgacgggatcaaggatgcggtggggttt
gagacccgcgtgaccgtgctggggcattaccagcggggcggcgctccctcggtgtttgac
cgtctgctgggcagccggtttggcaggaaatcggtggagctgctgctgtccggcaccaag
ggggtgatggtcgggctgtcagccaattcactgaccaccaccctgcttgagatggtggtc
aagggcggccagaagaagctgaacgaagacctgctacggatggccgacatcctagggatt
taa

DBGET integrated database retrieval system