KEGG   Geobacter lovleyi: Glov_2523Help
Entry
Glov_2523         CDS       T00708                                 

Definition
dihydropteroate synthase (EC:2.5.1.15)
Orthology
K00796  
dihydropteroate synthase [EC:2.5.1.15]
Organism
glo  Geobacter lovleyi
Pathway
Folate biosynthesis
Metabolic pathways
Class
Metabolism; Metabolism of cofactors and vitamins; Folate biosynthesis [PATH:glo00790]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
2698520..2699761
Genome map
AA seq 413 aa AA seqDB search
MTDTQGPGAQTAGRVSFVRALSLTSPAAAQKELERIGVDPAGIVRMLPKLEQQALLVPQV
RAAAANILKQEMLSLGGDAAVARGTVACSVSSTDVLLIGTRKQLLLLCSKLAGQPFGLKA
LALEIAAFLKTVQHPPACWQTSRRQLSLERPLIMGILNVTPDSFSDGGCYATIEKAVERA
LQLEAEGADLLDIGGESTRPGAPLISAEHELSRVLPVIEALANRLTIPISIDTWKSSVAE
ACLSAGAEIINDISGLNFDPDLAAVVARHQAGLVVMHTRGTPQQMQQDTGYADLLGEVAA
SLLQSAATARAAGITQAQICLDPGIGFAKDLHGNLELLRRLPELAKLGYPLLVGTSRKAF
IGRVLQREVAADRLFGTAATVAHAVTSGARIVRVHDVQAMRDVALMAHAINTR
NT seq 1242 nt NT seq  +upstreamnt  +downstreamnt
gtgaccgacacgcagggccctggggcacaaactgctgggcgcgtgtcgtttgtgcgcgcc
ctgagcctcacctcccctgcggcggcacaaaaagaactggaacgaatcggggttgatccg
gccggcatcgtccggatgctccccaaactggaacagcaggccctgctggtaccgcaggtc
cgggctgcagccgccaacatcctgaagcaggagatgctctccctggggggcgatgctgcg
gtggcacggggtaccgtggcctgttcagtcagcagtaccgacgtgttgctgatcggcacc
cgcaaacagctgctgctgctctgcagcaaactggcaggacagcccttcggcctcaaggcc
ctggcccttgagattgcggcttttctgaaaaccgttcagcatccgccggcctgctggcag
acctccaggcgtcaactctctctggagcggccgctgatcatgggcatcctgaatgtcacc
ccggattccttttccgacggcggttgctacgctacaattgaaaaggcggttgagcgggcc
ctgcaactggaagctgaaggggctgacctgcttgacatcggcggagaaagcacccggccc
ggggcaccgcttatttctgcggagcacgagctctcacgggtactgccggtgattgaggcg
cttgccaacaggctcaccatcccgatctcgatcgatacctggaaaagcagcgtggctgag
gcctgtctgtctgccggggcagagatcatcaatgacatcagcggcctgaactttgaccct
gatctggcagcggtggttgcccggcatcaggccggtctggttgtgatgcacacccggggc
actccccagcagatgcagcaggataccggctacgcggacctgctgggtgaggtggcggcc
agcctgttgcagtcggctgcaactgcccgtgctgccggcatcacccaggcacagatctgc
ctggaccccggcatcggctttgccaaggatctgcacggcaatctggaactgctgcgccgg
ctgcctgagctggcaaagcttggctacccgttgctggtgggaacctcacgcaaggccttt
atcggcagggttctgcagcgggaggttgctgccgaccggctgttcggcactgccgccacc
gtagcccatgccgtaacatccggcgcccggatagtgcgggtgcatgatgtgcaggccatg
agagatgttgccctgatggcccatgccatcaacacccgctaa

DBGET integrated database retrieval system