KEGG   Geobacter lovleyi: Glov_2688Help
Entry
Glov_2688         CDS       T00708                                 

Definition
glycerol kinase
Orthology
K00864  
glycerol kinase [EC:2.7.1.30]
Organism
glo  Geobacter lovleyi
Pathway
Glycerolipid metabolism
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:glo00001]
 Metabolism
  Lipid metabolism
   00561 Glycerolipid metabolism
    Glov_2688
Enzymes [BR:glo01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.30  glycerol kinase
     Glov_2688
Exosome [BR:glo04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   Glov_2688
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
complement(2887601..2889091)
Genome map
AA seq 496 aa AA seqDB search
MSFILALDQGTTSSRALVFDHDGTVRGLAQKEFRQIFPEPGLVEHDAEEIWASQLGVAVE
AVARAGLSAADIAAIGITNQRETTVVWDRRTGKPIHNAIVWQDRRTAAECDRLKRLGLEA
TFRARTGLVLDPYFSGTKLAWLLDHLPGARDKAERGELAFGTIDSWLVWNLTGGERHLTD
ASNASRTLLFNIHEGNWDQELLQLLRIPPAILPEVVPSSQVYGETAARFFAARVPISGIA
GDQQAALFGQLCDRPGMVKNTYGTGCFMLMQTGERPVLSERNLLTTVACRLGERTEYALE
GSVFAAGAAVQWLRDGLGIIRSSEEVETLAATVPDNGGVYLVPAFAGLGAPHWDPYARGT
LLGITRGSTAGHIARATLESIAFQTADLLEAMEADAATPLTELRVDGGATANNLLMQFQA
DLLGVPVVRPRVRETTALGAAYLAGLAIGYWQDRKELSRLWQAEQAFAPVLERERMAELR
YNWNRAVERSKGWAQP
NT seq 1491 nt NT seq  +upstreamnt  +downstreamnt
atgagttttattcttgcacttgaccaaggtaccaccagttcccgtgccctggtgtttgat
catgacggtacggtccggggtctggcccagaaggagtttcgccagatctttcccgaaccc
ggactggtggaacatgatgccgaggagatctgggcctcacaattgggggtggcggtggaa
gcagttgcccgggccgggctgagcgccgctgacatcgcggcaatcggcatcaccaaccag
cgggagacaacggtggtctgggatcgccgtaccggtaagccgatccacaatgcgattgtc
tggcaggaccggcgtactgccgcggagtgtgaccgtctcaaaaggctggggctggaagca
accttccgggccaggaccgggctggtgctggacccctatttctccggcaccaagctggcc
tggctgcttgatcacctgcccggtgccagggacaaggcagagaggggtgagctggccttc
ggcaccattgactcctggctggtctggaatctgaccggtggcgagcggcatctgaccgac
gccagtaatgcctcccgcaccctgctgttcaatatccacgagggaaactgggatcaggaa
ctgttgcagctgctccggattccgcctgcaattctgccggaggttgttccttccagccag
gtctacggtgagaccgctgcccgtttttttgctgcccgggtgccgatctccggtattgcc
ggggaccagcaggccgcgctgttcggccagctctgcgatcggcccgggatggtcaagaat
acctacggcaccggctgtttcatgctgatgcagaccggtgagcggccggtcctttcggag
cggaacctgcttaccaccgtggcctgccgcctgggggagcggaccgaatatgcccttgaa
ggcagcgtctttgcggccggtgccgcggtacagtggctgcgggacggcctggggatcatc
cgcagttcggaggaagttgaaacgctggctgccacggtaccggacaacggtggtgtctac
cttgtcccggcctttgccgggctgggagcgccccactgggacccttacgcccgcggtacc
ctgctgggcattacccgcggcagcactgccggccatatcgcccgggccaccctggaaagt
atcgccttccagaccgctgacctgctggaggcgatggaggcggacgctgctactcccctg
actgaattgcgggttgatggcggtgccactgccaacaatctgctgatgcagttccaggcc
gacctgttgggggtgccggtggtgcggcccagggtgcgggaaaccaccgccctgggggcg
gcctatctggccgggctggcaatcggctactggcaggaccgcaaggagctgagccggctc
tggcaggcggagcaggcctttgccccggtactggaacgtgaacggatggcggagttgcgt
tacaactggaacagggccgttgagcgctcaaaggggtgggcacagccatga

DBGET integrated database retrieval system