KEGG   Geobacter lovleyi: Glov_2717Help
Entry
Glov_2717         CDS       T00708                                 

Definition
(GenBank) succinyl-CoA synthetase, beta subunit
  KO
K01903  succinyl-CoA synthetase beta subunit [EC:6.2.1.5]
Organism
glo  Geobacter lovleyi
Pathway
glo00020  Citrate cycle (TCA cycle)
glo00640  Propanoate metabolism
glo00660  C5-Branched dibasic acid metabolism
glo01100  Metabolic pathways
glo01110  Biosynthesis of secondary metabolites
glo01120  Microbial metabolism in diverse environments
glo01130  Biosynthesis of antibiotics
glo01200  Carbon metabolism
Module
glo_M00009  Citrate cycle (TCA cycle, Krebs cycle)
glo_M00011  Citrate cycle, second carbon oxidation, 2-oxoglutarate => oxaloacetate
Brite
KEGG Orthology (KO) [BR:glo00001]
 Metabolism
  Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    Glov_2717
   00640 Propanoate metabolism
    Glov_2717
   00660 C5-Branched dibasic acid metabolism
    Glov_2717
Enzymes [BR:glo01000]
 6. Ligases
  6.2  Forming carbon-sulfur bonds
   6.2.1  Acid-thiol ligases
    6.2.1.5  succinate---CoA ligase (ADP-forming)
     Glov_2717
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: ATP-grasp_2 Ligase_CoA ATP-grasp_5 ATP-grasp CPSase_L_D2
Motif
Other DBs
NCBI-ProteinID: ACD96430
JGI: Glov2717
UniProt: B3E7B3
Position
2917487..2918650
Genome map
AA seq 387 aa AA seqDB search
MNIHEYQAKEILSTYGIPVPRNRVALTADQVERAAKMMGGHCVVKAQIYAGGRGKAGGVK
LVHHPEQASDVAKELFGKRLVTKQTGPEGLKVRRILVEETVEIAREFYLSITLDRETSRY
CLIASAEGGMDIEEVAQKSPDKIHVLTIDPFTGLRTYQARKIALALGLSGAVCEDCVELI
LNTYKCCLEKDCSLIEINPLVVTRAGWLLAMDAKISFDDNAVYRHREYPDMVDYSQLDPL
EITAGKYDLAYIKLTGNIGCMVNGAGLAMATLDVLKEFGGEPANFLDVGGGATREKVAEA
FKIILQDSDVKAVFVNIFGGIMRCDVIAQGIIEAANEVHCPLPIVVRMDGSNVEDGKKLL
LESGLNVQIGDNLGDGAQKIVAMLAKA
NT seq 1164 nt NT seq  +upstreamnt  +downstreamnt
atgaatattcatgaataccaggccaaggagatcttgagtacctacgggattccggtaccc
cgcaaccgggtggcgctgaccgcagaccaggttgagcgggccgccaagatgatggggggc
cactgtgtggtcaaggcccagatctatgccgggggcaggggcaaggccggcggcgtcaag
ctggtgcatcatccggaacaggccagcgacgttgccaaggagctgttcggcaagcgtctg
gtcaccaagcagaccggaccggagggtctgaaggtgcgccggattctggtggaagaaacc
gtggagatcgcccgggagttctacctctcgatcacccttgaccgcgagacctcccgctac
tgcctgatcgcctcggccgaaggggggatggatattgaagaggtggcccagaaatccccg
gacaagatccatgtcctgaccattgatcccttcaccggcctgcgcacctaccaagcccgc
aagatcgccctggccctgggtctctccggcgccgtctgtgaagactgcgttgagctgatc
ctgaacacctacaaatgctgccttgaaaaagactgttccctgatcgagatcaacccgctg
gtggtgacccgggccggctggcttttggccatggatgccaagatctcctttgatgacaac
gctgtctatcgccaccgtgaatacccggacatggtggactactcccagcttgacccgctg
gagatcacggccggcaagtacgacctggcctacatcaagctgaccggcaacatcggctgc
atggtcaacggcgccgggctggccatggccaccctggatgtgctgaaggagttcggcggc
gaaccggccaacttcctggatgtggggggcggcgccacccgcgaaaaggtggctgaggcg
ttcaagatcatcctgcaggacagcgacgtcaaggcggtcttcgtcaacatctttggcggc
atcatgcgctgcgacgtgatcgcccaggggattatcgaggcggccaacgaagtccactgt
cccctgccgattgtggtcaggatggacggcagcaatgtggaggacggcaaaaagctgctg
cttgaatcgggcctgaatgtgcagatcggtgacaacctgggcgacggcgcgcagaagatc
gttgccatgctggccaaggcgtaa

DBGET integrated database retrieval system