KEGG   Gloeocapsa sp. PCC 7428: Glo7428_0131Help
Entry
Glo7428_0131      CDS       T02400                                 

Definition
(GenBank) L-threonine synthase
  KO
K01733  threonine synthase [EC:4.2.3.1]
Organism
glp  Gloeocapsa sp. PCC 7428
Pathway
glp00260  Glycine, serine and threonine metabolism
glp00750  Vitamin B6 metabolism
glp01100  Metabolic pathways
glp01110  Biosynthesis of secondary metabolites
glp01120  Microbial metabolism in diverse environments
glp01230  Biosynthesis of amino acids
Module
glp_M00018  Threonine biosynthesis, aspartate => homoserine => threonine
Brite
KEGG Orthology (KO) [BR:glp00001]
 Metabolism
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    Glo7428_0131
  Metabolism of cofactors and vitamins
   00750 Vitamin B6 metabolism
    Glo7428_0131
Enzymes [BR:glp01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.3  Acting on phosphates
    4.2.3.1  threonine synthase
     Glo7428_0131
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: PALP ATP13
Motif
Other DBs
NCBI-ProteinID: AFZ28745
UniProt: K9X7X9
Position
152107..153267
Genome map
AA seq 386 aa AA seqDB search
MNSSPAKCLRLPNLNLNKVAANTVTLIANKSTNREVWSGLIKTYQQYLPVTENTPIVTLL
EGNTPLIPIPSIAQIIGRQVQVFAKYDGLNPTGSFKDRGMTMAISKAKEAGARAVICAST
GNTSAAAAAYAKRAEMKAFVLIPDGYVALGKLAQALLYGAEVLSIKGNFDQALKIVREMA
NSYPITLVNSVNPYRLEGQKTAAFEVVDALGEAPDWLCIPVGNAGNITAYWMGFCQYHQS
GKCDRLPRMMGFQAAGAAPLITGKAVTHPDTVATAIRIGNPANWEKAIAVQSASNGEFHA
VTDEEILAAYRLLASSEGIFCEPASAASVAGMLKVKDQIPTGATVVCVLTGNGLKDPNTA
IDNNQNAFKPGIEPTLEAVAEAMGVI
NT seq 1161 nt NT seq  +upstreamnt  +downstreamnt
gtgaattcatcgccagcgaaatgcttgcgcttaccgaatctcaatctaaataaagttgct
gcaaacaccgtgactctgattgctaacaaatctactaaccgcgaagtttggtctggacta
atcaaaacgtaccagcaatacttacctgtcactgaaaatacaccgatagtcactctatta
gagggtaatacgccgttgattccgattccctcaattgctcaaatcatcggtagacaagta
caggtattcgccaagtacgacgggttaaaccctacaggtagcttcaaagaccgaggaatg
acgatggcgatttccaaggcgaaagaagcaggggcgcgggcagttatttgtgcaagtacg
ggtaatacttccgccgccgctgccgcctatgcaaaacgtgcggaaatgaaagcttttgtg
ctgattcccgatggatatgttgctttaggtaaattggcgcaagcactgctttatggtgct
gaagtgttgtcgattaaaggaaactttgaccaagcattgaaaatcgtccgcgagatggca
aatagctatccgattactttggtaaattcagtcaatccttatcgtttagaaggacaaaaa
accgcagcgtttgaagttgttgatgctttaggtgaagctccagactggctatgcatccct
gtaggcaatgccggaaatatcacagcatactggatgggattttgtcaatatcatcaatcc
ggtaaatgcgatcgcttaccgcgaatgatgggctttcaagctgctggggctgcaccgtta
attaccggaaaagctgtaacgcaccctgataccgtcgcgaccgcaattcgcatcggcaat
ccggcaaactgggaaaaggcgatcgcggtacaatccgcaagcaatggagaatttcacgcg
gttactgatgaagaaatccttgcagcctaccgtttattagcatcctcagaaggcatcttc
tgcgaacctgcaagcgcggcttcggttgcgggtatgttaaaagtcaaagatcaaattcct
acaggtgcaaccgtcgtgtgcgtcctcaccggaaacggactcaaagaccccaacacagca
attgataacaatcaaaacgcattcaaaccaggaattgaaccgacactcgaagctgtagcc
gaagcaatgggagttatctaa

DBGET integrated database retrieval system