KEGG   Gloeocapsa sp. PCC 7428: Glo7428_0154Help
Entry
Glo7428_0154      CDS       T02400                                 

Definition
GTP cyclohydrolase I (EC:3.5.4.16)
Orthology
K01495  
GTP cyclohydrolase I [EC:3.5.4.16]
Organism
glp  Gloeocapsa sp. PCC 7428
Pathway
Folate biosynthesis
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:glp00001]
 Metabolism
  Metabolism of cofactors and vitamins
   00790 Folate biosynthesis
    Glo7428_0154
Enzymes [BR:glp01000]
 3. Hydrolases
  3.5  Acting on carbon-nitrogen bonds, other than peptide bonds
   3.5.4  In cyclic amidines
    3.5.4.16  GTP cyclohydrolase I
     Glo7428_0154
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
175681..176400
Genome map
AA seq 239 aa AA seqDB search
MTIGFPNGSPRSNSPLMPDSLEDTINRIATRPDRNTQNGKEAQLQPPSEELNEAMVEAVR
TMLLGVGEDPEREGLLKTPKRVVEAMRFLTSGYNQSLEDLVNNAIFDEGHNEMVLVRDIN
FFSLCEHHMLPFMGRAHVAYIPNEKVVGLSKLARIVEMYSRRLQVQERLTRQIAEAVQTI
LEPQGVAVVMEATHMCMVMRGVQKPGSWTVTSAMVGVFHDEQKTREEFLNLIRHQPAFF
NT seq 720 nt NT seq  +upstreamnt  +downstreamnt
atgactattggattccccaacggttctcctcgctccaactcacctttgatgccagatagt
ttagaagatacaatcaaccgcattgcgacacgaccagaccgcaatacccaaaatgggaaa
gaagcacaattgcaaccgccttccgaagaactcaacgaagcgatggtagaagcagtacgc
acgatgctattaggcgtgggagaagatccagaacgcgaggggctactcaaaactcctaag
cgcgtcgttgaagctatgcgctttcttaccagcggttataaccaatcattagaagacctt
gttaataacgccatctttgacgaaggtcacaacgagatggtacttgtgagagacattaac
ttctttagcttgtgcgaacatcatatgctgccatttatgggcagagcacacgttgcgtat
atccctaatgaaaaagtggtgggattaagcaagttagcgcggattgtggagatgtattcg
cgtcgcttgcaagtccaagaacgtcttacgcgtcaaattgccgaagctgtacagacgatt
ctagaaccccaaggtgttgctgtcgtcatggaagcaacgcatatgtgtatggtaatgcgc
ggcgttcaaaaaccagggtcatggacggtgactagtgcgatggtcggcgtatttcatgac
gagcaaaaaacgcgtgaagagtttttgaatttgattcgacatcagccagcgtttttctag

DBGET integrated database retrieval system