KEGG   Gloeocapsa sp. PCC 7428: Glo7428_0164Help
Entry
Glo7428_0164      CDS       T02400                                 

Definition
(RefSeq) L-threonine synthase (EC:4.2.3.1)
  KO
K01733  
threonine synthase [EC:4.2.3.1]
Organism
glp  Gloeocapsa sp. PCC 7428
Pathway
Glycine, serine and threonine metabolism
Vitamin B6 metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Biosynthesis of amino acids
Module
Threonine biosynthesis, aspartate => homoserine => threonine
Brite
KEGG Orthology (KO) [BR:glp00001]
 Metabolism
  Overview
   01230 Biosynthesis of amino acids
    Glo7428_0164
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    Glo7428_0164
  Metabolism of cofactors and vitamins
   00750 Vitamin B6 metabolism
    Glo7428_0164
Enzymes [BR:glp01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.3  Acting on phosphates
    4.2.3.1  threonine synthase
     Glo7428_0164
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-ProteinID: 
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
186037..187335
Genome map
AA seq 432 aa AA seqDB search
MTQAKTLNPTAATFKALKCKECGAEYELAASHVCEACFGPLEVTYDYNTLRRTVTRESIQ
SGPNSIWRYRSFLPVATENVIDVGTGMTPLVQANRLARRLGLKKLYIKNDAVNMPTLSFK
DRVVSVALSRARELGFSTVSCASTGNLANSTAAIAAHAGLDCCVFIPADLEAGKVLGTLI
YSPTVMAVQGNYDQVNRLCCEVANTYGWGFVNINLRPYYSEGSKTLGYEVAEQLGWQLPD
HIVAPLASGSLFTKIYKGFQEFIQVGLVEDKSVRFSGAQAEGCSPIAQAYKEGRDFVKPV
KPNTIAKSIAIGNPADGIYALEIARKTNGNIASVTDPEIIEGIKLLAETEGIFTETAGGT
TIAVLKKLVEAGKIDPDETTVAYITGNGLKTQEAVQGYIGEPLTIEAKLDSFERALERSR
TLERLDWQQVLV
NT seq 1299 nt NT seq  +upstreamnt  +downstreamnt
atgacccaggcaaaaaccctcaacccaacagcggcaaccttcaaagccctcaagtgtaaa
gaatgtggtgctgagtacgaacttgcagcaagccatgtttgtgaagcttgctttggtcca
ttggaagtcacctacgattacaacaccctccgccgtaccgtaacgcgcgaaagtattcaa
tcaggtcccaactcaatttggcgctatcgttctttcttacccgtcgcaactgaaaacgtc
attgatgtcggtacagggatgactcccctcgtacaagcaaatcgcttagctcgtcgcctg
ggattgaaaaagctctacatcaaaaatgatgccgttaatatgcccaccctcagtttcaaa
gatcgggtggtatctgtcgccttatcccgcgcccgcgaacttggtttttcaaccgtatcg
tgtgcgagtaccggaaatttagcaaattcaaccgcagcgatcgccgcccatgctggatta
gattgttgcgtcttcattcccgctgatctcgaagccggtaaagttttaggtacattaatc
tacagccctaccgtaatggcagtgcaaggtaactacgaccaagtaaaccgcttgtgttgt
gaagttgctaatacatatggttggggatttgtcaatatcaatttacgtccgtattactcc
gaaggttccaaaacgctgggttacgaagttgcggaacaactcggctggcaattacccgat
cacatcgttgcgcctttagcatcgggttctttattcaccaagatttacaaaggatttcaa
gagtttattcaagttggcttagtcgaagataaaagcgtacggttcagcggtgcgcaagct
gaaggttgttcccccatagcgcaagcctacaaagaaggacgcgattttgttaaacctgtt
aaaccaaatacaattgccaaatcaattgcgatcggaaatcctgctgatggtatctatgca
ctagaaattgcccgcaaaaccaacggtaatattgcatccgtcaccgatcctgagattatt
gaaggcatcaagctcctcgccgaaaccgaaggcatcttcaccgaaaccgcaggtggaaca
acgatcgcagttcttaaaaaattagtcgaagcgggtaagatcgatcctgacgaaaccaca
gtcgcctacattactggaaacggactcaaaacccaagaagccgtacaaggctacatcggc
gaaccgttgacgattgaagcgaagcttgatagttttgaacgagcattagagcgatcgcgc
actttagagcgtctcgactggcaacaagttttggtataa

DBGET integrated database retrieval system