KEGG   Gloeocapsa sp. PCC 7428: Glo7428_0424Help
Entry
Glo7428_0424      CDS       T02400                                 

Definition
Alkaline phosphatase
Orthology
K01077  
alkaline phosphatase [EC:3.1.3.1]
Organism
glp  Gloeocapsa sp. PCC 7428
Pathway
Aminobenzoate degradation
Folate biosynthesis
Metabolic pathways
Microbial metabolism in diverse environments
Two-component system
Class
Metabolism; Metabolism of cofactors and vitamins; Folate biosynthesis [PATH:glp00790]
Metabolism; Xenobiotics biodegradation and metabolism; Aminobenzoate degradation [PATH:glp00627]
Environmental Information Processing; Signal transduction; Two-component system [PATH:glp02020]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
474023..476074
Genome map
AA seq 683 aa AA seqDB search
MSSLCSIQFVWKRWKVVSLLIVITMIWLATVLPVQAQGANEELVRIWPTNNTTLLVGQRF
DLRVESLIPAQSTPKLESITINGNNFTGSFRQRINEQLQRPGGSIEVGQPPEGSNLFGQT
FRNWSLPQPGRYEIVATLNIDGRQVSARNTYRVQPFQQRGNLNKIIFFVGDGMGTPLRTG
ARLMKYGVKDGQPGGYLNLEQMPVTGLVATHSLNSIVPDSANTAAAWVSGAKTINNALNA
FPDNTPENPLDNPRIETLPQYMKRRYKWGIGMVTTAFTTDATPSSFAANQVQRAQYEAIA
QQYFDFFQDGWYLPETGYRSLKELSQPVDVLLGPGARHYVPDENAAAQFRDTVFRRDNQD
LVAVARQQGYSIVTDLNSMNQAPNDRPIFGLFLGDFREGAALGPQNTPSVLDLLIARGRA
TIDGRGASQLTPPVPSEFATIPTLEEMTKKAIAVLEAKSPQGWMLQVESSQSDKLAHPLD
PDRTLYEVLTLDDAVGEARQFVAQNPNALILVTADHAQGQTVGGTVDSQAIREGRIDLND
AMQSFEDAGFTTYQDTDGDGYPNEANPSIKLAIGISARPTFRTDFLTDDLNLPPSGEDGT
EPNPERDPNGLLLTNDLERETTVANHTADDVPIAAQGPGAGLFTGVMDNIEVFQRMAAVI
SGVRNRQDLATGRPSITAAEAES
NT seq 2052 nt NT seq  +upstreamnt  +downstreamnt
atgagcagtttatgctcaattcagtttgtgtggaagcgatggaaagtagttagtcttttg
atcgtcataacgatgatttggctagctactgtgttacctgtgcaagcgcaaggagcaaac
gaagaactagtacgcatctggcctacaaataacacaactttactggttgggcaacgcttt
gatttgcgtgtagaaagcttaattccggcgcagtcaacaccgaaattagagtctatcaca
atcaacggcaataactttactggaagttttagacagcgaatcaacgaacagctgcaacga
cctggtggttccatcgaagtcggacaaccgcccgaagggtcaaacctttttggtcaaaca
ttccgaaactggagtttacctcagccaggacgttacgaaattgtcgcaactttgaacatc
gacggacgccaagtttctgcacgcaatacgtaccgcgttcaaccatttcaacaacgaggt
aatttaaacaaaattatcttttttgttggcgatggtatggggacaccgttacgcacaggg
gcgcgtttgatgaaatacggtgttaaagatggtcaaccaggtggctaccttaatttagag
caaatgccagttacgggtttagtagctacgcactcactcaatagtattgttcccgattca
gcgaatactgcggctgcttgggtttctggggcaaaaaccattaacaatgcactcaatgcg
tttcctgacaatacacccgaaaatccgctggataatccgcgaattgaaactttaccccag
tacatgaagcggagatacaaatggggtattggaatggtgacaaccgcgtttacaacggac
gcgacaccttcatcctttgcagccaatcaagtacaacgcgctcaatatgaggcgatcgcg
caacagtattttgacttttttcaagatggttggtatttaccagaaaccggatatcgtagc
ttaaaagaattatcgcaacctgttgatgttctcctcggtccaggagcgcgtcattacgtc
cctgacgaaaacgccgcggctcaatttagagatacagtatttcgtcgcgataatcaagat
ctcgtcgctgttgctcggcaacaaggttacagtattgtcaccgacttgaacagcatgaat
caagctcctaacgatcgccccatctttggtttatttttaggagactttcgtgaaggtgcg
gctttaggtccacaaaatactccatcagtactcgatttattaattgcacgtggtagagca
acaattgacggtagaggcgcaagtcagctaactcctcctgtaccgtcagaatttgctaca
attcccacgctcgaagaaatgactaaaaaagcgatcgcggttcttgaagccaagtcgccc
cagggttggatgctgcaagttgagtcttcgcaatctgataaactcgcgcaccctctcgat
cccgatcgaacactttatgaagttttaactttggatgacgccgtaggagaagcacgccaa
ttcgttgcccaaaatcctaatgcactgattcttgtcactgcggatcacgctcaaggtcaa
actgtcggtggtacagtagactcacaagcaattcgcgaaggcagaattgatttaaatgat
gccatgcagtcgtttgaagatgcaggttttacaacttatcaagatacagatggcgatggc
tatccgaacgaagcaaatccaagcattaagttagcgatcggaatttccgcgcgaccaaca
ttccgcactgactttcttactgatgacttaaatttacctccttccggtgaggatggtact
gaacctaatcctgagcgcgatccgaatggtttactgctaaccaatgacttagaacgcgaa
actacggttgctaatcatacagcagatgatgttccgatcgctgctcaaggacctggagcc
ggattattcactggtgttatggataatattgaagtcttccaacgcatggctgctgttatt
tctggtgtgagaaaccgtcaagacttagcgactggtagaccatcgattactgctgcggag
gctgaatcatga

DBGET integrated database retrieval system