KEGG   Gloeocapsa sp. PCC 7428: Glo7428_0799Help
Entry
Glo7428_0799      CDS       T02400                                 

Definition
Glucosylceramidase (EC:3.2.1.45)
Orthology
K17108  
non-lysosomal glucosylceramidase [EC:3.2.1.45]
Organism
glp  Gloeocapsa sp. PCC 7428
Pathway
Other glycan degradation
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:glp00001]
 Metabolism
  Lipid metabolism
   00600 Sphingolipid metabolism
    Glo7428_0799
  Glycan biosynthesis and metabolism
   00511 Other glycan degradation
    Glo7428_0799
Enzymes [BR:glp01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.45  glucosylceramidase
     Glo7428_0799
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
876406..878835
Genome map
AA seq 809 aa AA seqDB search
MTQHQFSNIPPHTWNRPIGLGWDKPYTVRMASNIDDGPWHGMPLGGFGAGCIGRASRGDF
NLWHIDGGEHTFKSLPACQFSIFEQQASTSQAFALCTLPPADGTLTTWQWYPQHCENGVY
HALYPRSWFVYENVFQAHLSCEQFSPILPENYQETSYPVAVFVWRAHNPTNAPLTLSIML
TWQNTVGWFQNAIKNPEIRMRDDGSPVYEYEPCLGNNLGNFNRLIAKDNLCGCVLERVAS
DLQDGIGQWAIATPKQPNIEVFYHTRWNPSGDGAEIWHSFARDGSLPNTEDKTSASEQEQ
LAAAIAVRFTLQPGETRELPFAIAWDFPITEFAPGVKYFRRYTDFFGRGGDNAVAIAQTA
LQNYQSWQQQIQAWQQPILDRDDLPSVFKMALFNELYDLTSGGTLWSAADDRDPVGQFAV
LECFDYRWYESLDVRLYGSFALLMLWSKLEKSVIRAFARAIGQRDDRTRVIGYYYTQGLE
SPTALRKVAGATPHDLGAPNEHPWEATNYTSYQDCNLWKDLSCDFVLQVYRDFVLTGGTD
WELLWDCWSAVVQTLTYLKTFDLDEDGIPENSGAPDQTFDDWRLQGVSAYCGGLWLAALE
AAIAIGKTLLSYPDDHPASKILASAPDYPPIPETLDVFQSWLMRSRPIYQEKLWNGQYYR
LDSKSGSDVVMADQLCGQFYARLLGLPDIVPPECATQALKTVYDACFVKFHNGQFGAANG
LKPDGLPENPNATHPLEVWTGINFGLAAFLMQMGMKSEAWRITQAVVQQVYDNGLQFRTP
EAITAKGTFRACHYLRPMAIWAIYRVLTF
NT seq 2430 nt NT seq  +upstreamnt  +downstreamnt
atgacacagcatcaattctcaaacatccctccgcatacttggaatcgtcccatcggtctt
ggttgggataaaccttatactgtccgcatggcgagtaatatagatgatggtccttggcat
ggaatgcctttaggcggcttcggtgcagggtgtattggtcgcgcttcgcgtggcgatttc
aatttgtggcatattgatggtggcgaacatacttttaaaagtcttccagcgtgtcaattt
agtatatttgagcagcaagcatcgacgtcacaggcttttgcattatgtacactaccgcct
gctgatggcactttgacaacatggcagtggtatccacaacattgcgagaatggtgtttat
cacgcgctgtatcctcgcagttggtttgtttatgaaaatgtctttcaagcgcatctatct
tgcgagcagttttcaccaattttgccggagaattatcaggagacaagttatcctgttgct
gtgtttgtgtggagggcgcacaaccctacaaatgcgccactaacgttgagtattatgcta
acttggcaaaatacagtaggttggtttcaaaatgccatcaaaaatcctgaaatccgaatg
cgcgatgatggtagtccggtttatgagtacgagccttgtttaggtaataatctcggtaac
ttcaatcggttgattgctaaggataatctttgtggttgcgtgttagaacgcgttgcgagt
gatttacaagatggtatcggacagtgggcgatcgcaactccaaaacaaccaaacatcgaa
gttttctatcacactcgctggaaccctagcggggatggcgcagagatttggcacagtttc
gcccgtgatggatctttaccaaatacggaagataaaacttctgcaagtgaacaagaacaa
cttgcagcggcgatcgcggtgcggtttacactgcaaccaggagaaactcgcgaactacct
tttgcgatcgcgtgggattttcctatcactgaatttgcaccaggagttaagtattttcgc
cgttacaccgatttttttggtcgaggtggcgataatgcagtggcgatcgcgcaaaccgca
ttacaaaactatcaatcttggcaacaacaaattcaagcttggcagcaacctattttagat
cgggacgatctccccagtgtttttaaaatggcactgtttaacgaactgtacgacctcacg
agtggtggtacattgtggagtgccgcagacgatcgcgatccggttggtcaatttgcggtt
ttagaatgctttgattaccgctggtacgaaagtttagatgtcaggctgtatggttctttt
gccttattgatgctctggtctaaactggaaaaatcagtgatccgcgcctttgcaagagca
attgggcaacgcgacgatcgcactcgcgtgattggttactattacactcaggggctagaa
agtcccacagctttacgcaaagttgctggtgcaacaccgcatgacttaggcgcaccaaat
gagcatccttgggaagcgactaactatacaagttatcaagattgcaacttgtggaaagat
ttgtcgtgtgattttgtcttgcaagtttaccgcgattttgtgctgactggtggaactgat
tgggagttattgtgggattgttggtctgcggttgtgcaaacgctgacgtatttaaagacg
tttgatttagatgaagatggaattccagaaaattcaggcgcaccagatcaaacctttgac
gattggcgcttgcaaggtgtcagtgcttattgtggcggattgtggttagctgcattagaa
gcggcgatcgcgatcggtaaaactttactcagttaccctgacgatcatcctgcaagtaaa
attctggcttctgcgcccgattacccacccattcctgaaacgcttgatgtatttcaatct
tggttaatgcgatcgcgcccaatatatcaagaaaaactgtggaatggtcaatactatcgc
ctcgatagcaagagtggttcagatgtcgtaatggcagatcaactgtgcggacaattttat
gcacgattactcggtttacctgacattgtgcctccagaatgtgctacgcaagccttgaag
acagtttatgatgcttgctttgtgaaatttcataatggtcaatttggcgcggctaatggc
ttaaaacccgatggtttgccagaaaaccccaacgcgacgcatcctctggaagtttggaca
ggaattaactttggactggcggcgtttctgatgcaaatgggtatgaaatctgaagcatgg
cgaattacgcaagctgttgtacagcaagtttacgacaacggattacagtttcgcactccc
gaagcgattaccgccaaaggaacatttcgcgcgtgtcactacctgcgccctatggcaatt
tgggcaatttatcgcgtattgactttttaa

DBGET integrated database retrieval system