KEGG   Gloeocapsa sp. PCC 7428: Glo7428_0808Help
Entry
Glo7428_0808      CDS       T02400                                 

Definition
Glucokinase (EC:2.7.1.2)
Orthology
K00845  
glucokinase [EC:2.7.1.2]
Organism
glp  Gloeocapsa sp. PCC 7428
Pathway
Glycolysis / Gluconeogenesis
Galactose metabolism
Starch and sucrose metabolism
Amino sugar and nucleotide sugar metabolism
Streptomycin biosynthesis
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Carbon metabolism
Module
Glycolysis (Embden-Meyerhof pathway), glucose => pyruvate
Brite
KEGG Orthology (KO) [BR:glp00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    Glo7428_0808
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    Glo7428_0808
   00052 Galactose metabolism
    Glo7428_0808
   00500 Starch and sucrose metabolism
    Glo7428_0808
   00520 Amino sugar and nucleotide sugar metabolism
    Glo7428_0808
  Biosynthesis of other secondary metabolites
   00521 Streptomycin biosynthesis
    Glo7428_0808
   00524 Butirosin and neomycin biosynthesis
    Glo7428_0808
Enzymes [BR:glp01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.2  glucokinase
     Glo7428_0808
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
887037..887957
Genome map
AA seq 306 aa AA seqDB search
MMSAASDSPQPQVIGIDLGGTAIKLGKFAQDGTCLGSLIVATPQPATPQAVVDVMVDAIA
QIDPDNQCLAIGVGTPGPADVSGRIARVAINLHNWRDVPLADWLEAKTGRLAVLANDANC
AGLGEAWLGAGRRFRHLILLTLGTGVGGAVILDGHLFVGHQGTAAELGLITLNLDGPPCN
SGNYGSLEQYVSVQAIRRRTGLEPAQLCALAKAGDTEALTFWRQYGKELGAGLASLIYVL
TPEAIIIGGGVSASAEFFFPSVHAEIECRVLPSSRTGLEILTAELGNQAGMVGAARLAWD
KIKNQD
NT seq 921 nt NT seq  +upstreamnt  +downstreamnt
atgatgagcgcagcatcagattcacctcagccccaagttatcggtattgacttgggtgga
accgcaattaaattaggaaaatttgcgcaagatggtacttgtctaggatcgttaattgtc
gccactcctcaacccgcaacaccacaggcggttgttgatgtgatggtagatgcgatcgcg
caaattgatcctgacaatcaatgtctcgcgatcggtgttggtacgccaggtcctgcggat
gtttctggacgaattgcgcgagtggcaattaatcttcacaactggcgcgatgttccttta
gccgattggctagaagcgaaaacaggtcggcttgcggttctggctaacgacgctaactgt
gctgggttgggtgaagcatggttaggcgcaggacgccgctttcgtcacttaattctgctt
actttgggaacgggtgtcggcggtgcagtgattctcgatggtcatctctttgtcggacat
cagggaaccgctgctgaactcggattaataactttaaaccttgatggtccaccttgtaat
agtggcaattacggttctttagagcaatacgtctcagttcaggcaattcgtcgccgcact
ggactcgaacccgcacaactctgtgcgcttgccaaagcaggagacacggaggcattgact
ttttggcggcagtatggtaaagaattgggtgcgggtttagcgagcttgatttacgtttta
acgcctgaagccatcattattggtggtggggtgagcgccagcgcagagtttttctttccc
agcgttcatgcggaaattgaatgccgcgtactaccgagttctcgcacaggattagaaatc
ctcacagctgaactcggcaaccaagccggaatggtaggagccgcgcggcttgcgtgggac
aaaataaagaatcaggattaa

DBGET integrated database retrieval system