KEGG   Gloeocapsa sp. PCC 7428: Glo7428_1120Help
Entry
Glo7428_1120      CDS       T02400                                 

Definition
MCP methyltransferase, CheR-type with PAS/PAC sensor (EC:2.1.1.80)
Orthology
K13924  
two-component system, chemotaxis family, CheB/CheR fusion protein [EC:2.1.1.80 3.1.1.61]
Organism
glp  Gloeocapsa sp. PCC 7428
Pathway
Two-component system
Bacterial chemotaxis
Brite
KEGG Orthology (KO) [BR:glp00001]
 Environmental Information Processing
  Signal transduction
   02020 Two-component system
    Glo7428_1120
 Cellular Processes
  Cell motility
   02030 Bacterial chemotaxis
    Glo7428_1120
Enzymes [BR:glp01000]
 2. Transferases
  2.1  Transferring one-carbon groups
   2.1.1  Methyltransferases
    2.1.1.80  protein-glutamate O-methyltransferase
     Glo7428_1120
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.1  Carboxylic-ester hydrolases
    3.1.1.61  protein-glutamate methylesterase
     Glo7428_1120
Two-component system [BR:glp02022]
 CheA family
  CheA-CheYBV [MD:M00506]
   Glo7428_1120
Bacterial motility proteins [BR:glp02035]
 Flagellar system
  Chemotaxis proteins
   Two component system proteins
    Glo7428_1120
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1227643..1229487
Genome map
AA seq 614 aa AA seqDB search
MNPDFEALLNYIKRSRGIDFTSYKRPSLMRRVGKRMQAIEVDNYSNYIDYLEVHPQEFVH
LFNTILINVTSFFRDPTVWEYVQTEIIPRIIARKESSEPIRVWSAGCASGQEAYTLAIVL
AEALGVEQFRARVKIYATDVDEEALNSARHAVYNVREVAGLSPELLERYFDRYENLYTFR
KDLRRSVIFGRHDLVQDAPISRIDLLVCRNTLMYFNAEAQARIISRFHFALNDSGFLVLG
KAEMLLSHSNSFTPVDLKRRIFSKLATANNRDRFLLMVPNNDIDTNNYLTPHGYLRDAAF
DATPLAQIIFDVNGLLTLANERSRSLLGLNYRDIGRLLQDLEISYRPIDLRSCIEQVYRD
RRPHLYKDVEWTTGGEPQYFDIQVAPLLDVNSIILGFSITFNDVTRAKCLQDELEHSNQE
LEMAYEELQSTNEELETTNEELQSSNEELETTNEELQSTNEELETMNEELHSSNEELHTT
NEEFRLRSEELNAANAFLASILTSLRCGVVVLDRDLLILAWSDKAEDLWGLRALEVQGQH
FLNLDIGLPVQQIRQPIRTCLTAESDYTEITVNAINRRGKLIQCKVTCTPLLSRTQEIQG
VILLMEEKASEELQ
NT seq 1845 nt NT seq  +upstreamnt  +downstreamnt
atgaacccagattttgaagctttactcaattacatcaagcgtagtcgtggaattgatttt
actagttataaacgaccaagcttaatgcgtcgtgtcggaaaacggatgcaagccatcgag
gttgataactacagcaattacatcgattacctagaggtgcatccccaagaatttgtgcat
ttgtttaacacaattttaattaacgttacctctttttttcgcgatcctacggtgtgggaa
tatgtacagactgagattattccccgcataattgcccgtaaggaatcctccgaaccgatt
cgagtttggagtgcaggctgtgcttctggacaagaagcctacactttggcgatcgtgcta
gcagaagcactcggagtcgaacagtttcgcgcgcgtgtcaaaatttatgcgaccgatgtt
gatgaagaagcgctcaattccgcgcgtcatgcagtttataacgtaagagaagtggcaggg
ctttcgccagaacttttagaacggtattttgatcgctacgaaaatctttataccttccgt
aaagacttgcgccgttccgtaatttttggtcgtcacgatctagtgcaagatgcaccgatt
tcgcgcattgatttattagtttgtcgcaacacgctgatgtatttcaatgccgaagcccaa
gccagaattatcagtcgctttcactttgccttgaatgatagtggatttttagtattaggc
aaagcagagatgttactcagccatagtaatagttttactccagtagacctcaaacgacgc
atttttagcaagctggcaactgcaaataatcgcgatcgctttttgttaatggttccaaac
aacgatatagacacaaataactatctaacgcctcatgggtatctccgcgatgccgctttt
gatgcgactccactcgcacaaattatatttgacgttaatggcctcttaactttagctaac
gagcgatcgcggagtttgctcggtttgaactaccgagatatcggtcgtttactacaagac
ttggaaatatcgtaccgtccgatcgatttacgttcgtgcattgagcaagtgtatcgcgat
cgccgtcctcatctttacaaagatgtcgaatggacaacgggtggagaaccgcaatatttt
gatattcaagtcgcaccgcttttagatgtcaacagtatcatactcggttttagtatcacc
ttcaacgacgtgacgcgtgctaaatgcttacaagatgaacttgagcattctaatcaagaa
ttagaaatggcttacgaagaattacaatccacaaatgaagaactagagacaaccaacgaa
gaattgcaatcttctaatgaggaattagagacaaccaacgaggaacttcaatctacaaac
gaagagttagaaaccatgaacgaggaattacactcttctaatgaagaactccacacaact
aacgaagaatttcgcttgcgcagcgaagaactcaacgccgctaatgcgtttttagcgtca
attttaacaagtcttcgttgtggtgtcgtcgttttagaccgagacttgcttatcctagct
tggagtgacaaagccgaagatttatggggtttacgcgcccttgaagttcaaggacaacac
ttccttaatttagatattggtttacccgtacaacagattagacaaccaattcgcacctgt
cttacggcagaatctgattatacagaaattactgtaaacgcaatcaatcgccgtggcaaa
ctcattcaatgtaaagttacgtgtacgccattgttgagtagaacacaagaaattcaaggc
gtcattttgttaatggaagaaaaagcaagcgaagagttacaataa

DBGET integrated database retrieval system