KEGG   Gloeocapsa sp. PCC 7428: Glo7428_1254Help
Entry
Glo7428_1254      CDS       T02400                                 

Definition
4-alpha-glucanotransferase (EC:2.4.1.25)
Orthology
K00705  
4-alpha-glucanotransferase [EC:2.4.1.25]
Organism
glp  Gloeocapsa sp. PCC 7428
Pathway
Starch and sucrose metabolism
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:glp00001]
 Metabolism
  Carbohydrate metabolism
   00500 Starch and sucrose metabolism
    Glo7428_1254
Enzymes [BR:glp01000]
 2. Transferases
  2.4  Glycosyltransferases
   2.4.1  Hexosyltransferases
    2.4.1.25  4-alpha-glucanotransferase
     Glo7428_1254
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(1377511..1379022)
Genome map
AA seq 503 aa AA seqDB search
MPFPRASGILLHPTSFPSKFGIGDLGESAYSFIDFLVQSAQQLWQVLPLGPTGYGNSPYA
SYSAMAGNPLLISPESLEKQGLLTAEDFVNLPEFPRNKVDFDQVVPIKLPLLKKACENFR
AKATPQQQQEFAQFCTAKADWLDDYALFMALKDTNEGVSWYQWEPEIARRHPEALARSQQ
QLEAEIFYHKFVQFEFFRQWNELKHYANQQGIVIIGDIPIYVAHDSADVWANPEIFCLDE
ATGEVALMAGVPPDYFSETGQLWGNPVYNWEKLQRLNFKWWVQRFQAILDYVDIIRIDHF
RGFQAYWAVEQGETTAMNGEWIEAPGEALFQAINEQLGKLPVLAEDLGVITPEVEALRDR
FEFPGMKILQFAFGSDAANPFLPFNFPRNCVVYTGTHDNDTTVGWFNSASEYEKERLQRY
LGCLSSDGIHWDLIRLALSSVANQALIPLQDLLGLPTEARMNYPSKPEGNWEWRYTSDDL
TSELRDRLKSLTELYGRAPISRE
NT seq 1512 nt NT seq  +upstreamnt  +downstreamnt
atgccttttcccagagctagtggtattctgctacatcccacctccttcccaagtaaattt
ggcatcggcgatcttggcgaatctgcttattcctttattgattttttagtacaaagcgcg
caacagttgtggcaggttttaccactaggacctacaggttatggtaactctccttatgcc
tcatactcggcaatggcgggtaatcctctgttgattagcccagaaagcttagaaaaacaa
gggttgttgacagccgaggacttcgttaatttaccagagtttccgcgcaacaaagttgat
tttgaccaagttgtaccaattaagcttcctttactcaagaaagcttgcgaaaattttagg
gcaaaagcaacaccgcaacaacagcaagaattcgcgcaattctgtacagccaaagctgat
tggttagatgattatgcgctattcatggcgctgaaagatacgaatgaaggtgtcagttgg
tatcaatgggaaccagaaatcgcgcgtcgtcatccagaggctttagcgcgatcgcagcaa
cagctagaagcagaaattttctaccacaaatttgtacagtttgagtttttccgccagtgg
aatgaactcaaacactacgcgaatcagcagggtatcgtcatcattggtgatatcccgatt
tatgtagcgcatgatagtgctgatgtctgggcaaatccagagattttttgtttggacgaa
gcgacgggcgaagtcgctttgatggcgggagttcccccagattactttagtgaaacaggt
caattgtggggcaatcctgtatacaactgggagaagttacagcgactcaatttcaagtgg
tgggtgcagcgttttcaagcaatcctagattacgttgatattattcggattgaccacttt
cggggatttcaagcttactgggcggtagaacaaggagaaactaccgcaatgaatggagag
tggattgaagccccaggggaagcgttatttcaagcaattaacgaacagttgggtaagctt
cctgtgttagccgaagatttaggcgtgattacgcctgaagttgaggcgctgcgcgatcgc
tttgaatttcctggaatgaagattttgcagtttgcctttggttcggatgcggctaatcct
tttttaccattcaactttccgcgtaactgcgtcgtatacacaggaacgcacgataatgat
acaacagtaggctggtttaacagtgcttctgagtacgaaaaagaaagattacagcgttac
ttgggttgtttaagttctgatggtattcactgggatctcattcgcctagcattaagttcg
gtagcaaatcaagcgctgattccactccaggatttattgggcttaccgacagaagcacgc
atgaattatcccagtaaacccgaaggtaactgggaatggcgctatacttcagacgatctc
acttctgagttgcgcgatcgcctcaaatccttgacagaattatacggtcgtgcccccata
agtagggagtag

DBGET integrated database retrieval system