KEGG   Gloeocapsa sp. PCC 7428: Glo7428_1332Help
Entry
Glo7428_1332      CDS       T02400                                 

Definition
dTDP-4-dehydrorhamnose 3,5-epimerase (EC:5.1.3.13)
Orthology
K01790  
dTDP-4-dehydrorhamnose 3,5-epimerase [EC:5.1.3.13]
Organism
glp  Gloeocapsa sp. PCC 7428
Pathway
Streptomycin biosynthesis
Polyketide sugar unit biosynthesis
Metabolic pathways
Biosynthesis of secondary metabolites
Class
Metabolism; Metabolism of terpenoids and polyketides; Polyketide sugar unit biosynthesis [PATH:glp00523]
Metabolism; Biosynthesis of other secondary metabolites; Streptomycin biosynthesis [PATH:glp00521]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1467536..1468087
Genome map
AA seq 183 aa AA seqDB search
MRFIETSLKGAYIIDLEEKPDHRGFFARTYCAEEFAAHGLKATVAQCNLSFNHYKGTLRG
MHYQVAPACETKLVRCIAGAIYDVIVDMRPDSPTYLQHIGVELTAQNRRALYVPEMFAHG
YQALTDGAEVVYQVGEFYTPGYERGLRYDDPVLAIDWPLPVSEISAKDASWALLDSLLVG
SYA
NT seq 552 nt NT seq  +upstreamnt  +downstreamnt
atgagatttattgaaacctcactcaaaggcgcatacatcattgatttagaagaaaaacct
gaccatcgtggcttctttgcccgcacctattgcgctgaagaattcgccgcgcatggactc
aaagccaccgtcgcccaatgcaacttatcgtttaaccactacaaaggaacactgcgcgga
atgcactatcaagtcgcacctgcgtgtgaaacgaaacttgtgcgttgtatcgctggggca
atttatgacgtgattgtcgatatgcgccccgactcaccgacgtatttgcaacatatcggt
gtcgagttaactgcgcaaaatcgtcgcgcgttgtatgtcccagagatgtttgcgcacgga
tatcaagcactcacggatggtgcagaagttgtttatcaggtgggcgagttttacactcct
gggtatgagcgcgggttgcgttatgatgaccctgttttagcgattgattggccgttacct
gtcagtgagatttctgccaaagatgcttcttgggctttgttggattctttgcttgtgggt
agctatgcttaa

DBGET integrated database retrieval system