KEGG   Gloeocapsa sp. PCC 7428: Glo7428_1496Help
Entry
Glo7428_1496      CDS       T02400                                 

Definition
magnesium chelatase, H subunit (EC:6.6.1.2 6.6.1.1)
Orthology
K03403  
magnesium chelatase subunit H [EC:6.6.1.1]
Organism
glp  Gloeocapsa sp. PCC 7428
Pathway
Porphyrin and chlorophyll metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:glp00001]
 Metabolism
  Metabolism of cofactors and vitamins
   00860 Porphyrin and chlorophyll metabolism
    Glo7428_1496
Enzymes [BR:glp01000]
 6. Ligases
  6.6  Forming nitrogen-D-metal bonds
   6.6.1  Forming coordination complexes
    6.6.1.1  magnesium chelatase
     Glo7428_1496
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1660206..1664171
Genome map
AA seq 1321 aa AA seqDB search
MQRIVLIAGFESFNADLYRKAALLAEERCPELAIEVFSDRDITARPDAVAAALAEAQVFF
GSLLFDYDQVLWLRDRVEHIPIRLVFESALELMSLTRLGAFAIGDKPKGMPKPVKFILDK
FSQGREEDRLAGYISFLKIGPKLLKFVPGQKVQDLRNWLIIYGYWNAGGVENVAALFWTL
AQKYLGIKVGEIPPPVETPNMGLLHPDYQGYFESPREYLEWYQSRSQRSEVRGQSRVGIL
LYRKHVVTRQPYIPQLIRRFEEAGFIPLPIFINGVEGHVAVRDWMTTAYETAQRQSGNIE
TPSLSPEAVEVDAIVSTIGFPLVGGPAGSMEAGRQVEVAKRILSAKNVPYIVAAPLLIQD
IYSWTRQGVGGLQSVVLYALPELDGAIDPVPLGGLVGEKIYLIPERVQRLIGRVKKWIAL
RQKPASQRKIAVILYGFPPGYGATGTAALLNVPRSLLKFLQALKEHGYTVGDLPADGEEL
IRQVKAADEDPSLGNVTNTRTLETWLGYLKTSWIEKHWKSLTSSGIKTYGDDFHIGGVQL
GNVWIGVQPPLGIPGDPMRLMFERDLTPHPQYAAFYQWLQHEFQADAVVHFGMHGTVEWL
PGSPLGNTGYSWSDILLGNLPHLYVYAANNPSESILAKRRGYGVLISHNVPPYGRAGLYK
ELVALRDLIAEYREDPEKNYALKAAICKKIVDTGIDADCPFEDAKRLGIAFTPENARMFS
NAAFNHYLVQMYEYLQVLENRLFSSGLHTLGEAPTSEELASYLQAYFGEELSEEIIDAIA
QGNTIEYGQGNALPQPHQKSHTSPQPHQKSYTLPQPHQKSYTLPQPHQKSHTSPQPHQKS
YTLPQPHQKSYTLPQPHQKSHTSPQPHQKSYTLPQPHQKSYTLPQEALQIRDLLAQNTDE
IANLLRGLNGEYIPPAPGGDLLRDGIGVLPTGRNIHALDPYRMPSPAAYERGKEIAQNII
AQHLQEHKTYPETIAVMLWGLDAIKTRGESLGILLELVGAEPVKEGTGRIVRYELKPLSE
VGHPRIDVLGNLSGIFRDSFVNIIELLDDLFQRAATVDEPEEQNFIRKHYLALRSQGVEN
ASARLFSNPAGDFGSMVNERVVDGNWESGDELGNTWRDRNVFSYGRQDKGQARPEVLTQL
LQKCDRIVQEIDSVEYGLTDIQEYYANTGGLKKAAEKQRGKKVNASFVESFSKDTTPRNL
DDLLRMEYRTKLLNPKWAEAMANQGSGGAFEISQRMTALIGWGGTADFSDSWVYDQAADT
YALDPEMAEKLRKANPEAFRNIVGRMLEAHGRGFWQADAEKLEKLRELYELADEELEGVT
I
NT seq 3966 nt NT seq  +upstreamnt  +downstreamnt
atgcaacgcattgttttgattgcggggtttgaatcgttcaatgctgacttgtaccgcaaa
gcagcactgttagcagaagaacgctgtccagagttagccattgaggtatttagcgatcgc
gatatcacagcaagacccgatgcagtcgccgccgcgctggcagaggcccaagtgtttttt
ggtagtctactatttgattacgaccaagttttgtggctgcgcgatcgcgttgaacatatt
ccgattcgccttgtttttgaatcagcactcgaattaatgagtttaacgcgcctgggggcg
tttgcgatcggtgataagcccaaaggaatgcccaagccggtaaagttcatcttagataaa
tttagtcaaggacgcgaagaagatcgcctcgctggatatattagctttttaaaaattgga
cccaaactcctcaaattcgttcctgggcaaaaagttcaagacctgcgcaactggctgatt
atttacgggtactggaatgcaggcggtgtagaaaacgttgctgccttattttggacactc
gcacaaaagtatttaggtatcaaagttggtgagattccaccacctgtggaaacacccaac
atgggattgctgcatcctgattatcaaggttactttgaatctccgcgcgagtatcttgaa
tggtatcaaagtagaagtcagaggtcagaggtcagaggtcagagtcgtgtaggaatattg
ttatatcgaaagcacgttgttacgcgacagccgtatattccacagttgattcgccgtttt
gaagaggcaggattcattccattgccaatttttatcaatggtgtcgaaggtcatgtcgca
gtccgtgactggatgacgaccgcgtatgaaactgcacaacgacagtcggggaatattgaa
actccttcgttatcaccggaagctgtagaagttgatgcgatcgtctcgacaattggcttt
ccgttagtcggtggtcccgcaggttcgatggaagcaggacgacaggtggaagtcgcaaag
cgaattttgagtgcaaaaaatgtaccgtatattgttgctgcaccgttactcattcaagat
atttattcgtggacacgccaaggtgtagggggattgcaaagtgtcgtgttatatgcattg
ccagaacttgatggcgcgattgatccggttcccttgggtggattggtaggcgagaagatt
tatttaattcccgaacgcgtacagcggttgattggcagggtcaaaaaatggattgctttg
cgtcaaaagccagcgagtcagcgcaagattgcggttattttgtatggttttcctcctggt
tatggcgcaacaggaactgccgctttattgaatgtaccgcgatcgctcctgaaatttctc
caagcgttgaaagagcatggctacactgttggagacttacccgcagatggcgaagaatta
attcgtcaggtgaaagccgctgatgaagatccatccctaggcaatgttacaaatactcgc
actttagaaacgtggcttggttatctcaaaacatcttggatagaaaaacattggaaatca
ttaacaagtagtggtatcaaaacctatggcgatgattttcatattggtggcgtacaactt
ggtaacgtttggattggcgtacagcctccactcggaattcctggcgatccgatgcggcta
atgtttgagcgggacttgacaccgcatccacaatatgcagcattttatcaatggttgcag
catgaatttcaagctgatgcggttgttcactttgggatgcatggcacagtcgaatggttg
cctggttcgccgttgggaaatactggttactcgtggtcagatattttattgggtaacttg
ccacatttatatgtatatgcagcgaataatccttcagaatcgattttggcaaagcgtcgg
gggtatggtgtcttaatatcgcacaatgttccgccttacggtcgggcagggttgtataaa
gaattagtcgcattacgggatttaattgcagagtaccgcgaagatcctgaaaagaattat
gctttgaaagcagcgatttgcaagaaaattgtcgatacaggaatcgatgccgattgtcca
tttgaggatgcaaaacgcttaggcattgcgtttacaccagaaaatgcacggatgtttagt
aacgcggcattcaaccattacttagtgcaaatgtatgaatatttacaagtactagaaaac
cgcttattttcctcaggattgcatacactaggagaagcaccaacctccgaagaattagca
agctaccttcaagcttacttcggcgaagaattatccgaagagataatagatgcgatcgca
caaggcaataccatcgagtacgggcaaggcaatgccttgccccaacctcaccaaaaatct
catacctcgccccaacctcaccaaaaatcttataccttgccccaacctcaccaaaaatct
tataccttgccccaacctcaccaaaaatctcatacctcgccccaacctcaccaaaaatct
tataccttgccccaacctcaccaaaaatcttataccttgccccaacctcaccaaaaatct
catacctcgccccaacctcaccaaaaatcttataccttgccccaacctcaccaaaaatct
tataccttgcctcaagaagctttacaaatccgcgatctcttagcacaaaatactgatgag
atcgcaaacctacttaggggactcaatggcgaatacattccgcctgcgcctggtggtgac
ttgttacgcgatggaattggtgttttaccaacagggcgcaatattcacgcgctagatcct
taccgaatgccatcaccagcagcgtacgaacgcggcaaagaaatcgcgcaaaatatcatt
gcccaacacctgcaagaacacaaaacatatcctgaaacgatcgctgtaatgttgtgggga
ttagatgcaattaaaacacggggtgaatcgttgggaattctcttagaacttgttggcgct
gaacccgtcaaagaaggaactggaagaattgtgcgctacgagttgaaacctttatcggaa
gtaggacatcctcgaattgatgtattaggaaatctttcagggattttccgcgatagcttt
gtgaatattatcgaactactcgacgatttatttcaacgcgccgcaacggtagacgaacca
gaagagcaaaactttattcgcaagcattatttagccctgcgatcgcaaggagttgaaaac
gcttcggcacggttattttctaatccagcgggcgattttggttcaatggtgaatgaaaga
gttgttgatggtaactgggaatcgggtgatgagttggggaatacttggcgcgatcgcaat
gtctttagttacggtagacaagataaaggtcaagcacgaccggaagtattgacccaatta
ttgcaaaagtgcgatcgcattgtgcaggaaattgattcggtagaatacggtctgactgat
attcaagaatactatgctaatacgggtggcttaaaaaaggcagcagaaaagcaacgcgga
aagaaagtcaacgccagttttgtcgaaagcttctcgaaagatacaactccgcgaaattta
gatgatttattacggatggaataccgcacaaagttacttaatcccaagtgggcggaagca
atggcaaatcaaggttctggcggtgcgtttgagatttcccaacggatgacagctttgatt
ggttggggcggtactgctgattttagcgattcttgggtttatgaccaagcggcggatacg
tatgcactcgatccagaaatggctgagaaattacgcaaggcaaatcctgaagcttttcgt
aatattgttggcagaatgttagaagcccacgggcgaggtttttggcaagctgatgcagag
aaactagaaaaattgcgagagttgtatgaattagctgatgaggaattagaaggtgtaacg
atttag

DBGET integrated database retrieval system