KEGG   Gloeocapsa sp. PCC 7428: Glo7428_2366Help
Entry
Glo7428_2366      CDS       T02400                                 

Definition
4-diphosphocytidyl-2-C-methyl-D-erythritol kinase (EC:2.7.1.148)
Orthology
K00919  
4-diphosphocytidyl-2-C-methyl-D-erythritol kinase [EC:2.7.1.148]
Organism
glp  Gloeocapsa sp. PCC 7428
Pathway
Terpenoid backbone biosynthesis
Metabolic pathways
Biosynthesis of secondary metabolites
Module
C5 isoprenoid biosynthesis, non-mevalonate pathway
Brite
KEGG Orthology (KO) [BR:glp00001]
 Metabolism
  Metabolism of terpenoids and polyketides
   00900 Terpenoid backbone biosynthesis
    Glo7428_2366
Enzymes [BR:glp01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.148  4-(cytidine 5'-diphospho)-2-C-methyl-D-erythritol kinase
     Glo7428_2366
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
2670055..2671035
Genome map
AA seq 326 aa AA seqDB search
MPLVVRPQKMHSYSLIAPAKINLYLEIIGDRPDGYHELAMVLQSISLADQIDIRAASTDT
IRVRCEHPQVPTDKSNLAYKAAALMANQFPDAFAQYGGVDITINKEIPVAAGLAGGSTNA
AAVLVGIDLLWELGLTQSELEELAGKLGSDVPFCIAGGTAIATGRGNELSQLPNLDNLYV
VLGKYRSLAVSTAWAYQTYRQQFGDSYLTDTHSLTSRAAAVHSGPIVKAIARKDGVQIAE
KLHNDLERVVLPEYPQVAQLRQVFQEAGGLGAMMSGSGPTVFALCESHEQAQQVQQYVRK
AIPDPDLELWLAQTCSTGIQVATSAK
NT seq 981 nt NT seq  +upstreamnt  +downstreamnt
gtgcccttagtggttcgtccccaaaaaatgcattcctactcactcattgcccccgccaaa
attaacttatatttagaaatcatcggcgatcgccccgatggatatcacgaattggcgatg
gtcctccaaagcatcagtctcgccgatcaaatcgatatccgcgctgcaagtaccgacaca
atccgcgtccgctgcgaacatcctcaagttcccaccgataaaagcaacttagcgtacaaa
gccgcagcattgatggcaaaccaatttcccgatgcttttgcgcaatatggtggtgtggac
attacgattaataaagaaattcctgtcgccgctggattggctggcggctcgacaaacgcc
gctgcggtattagtcggaatcgatttattatgggaactaggactcacgcaatctgaactc
gaagaacttgcaggaaaactaggttcagatgttcccttttgtattgcaggtggaaccgcg
atcgccacaggtagaggtaacgaactgtcacaattacccaacctagataatctctacgtt
gttttaggaaaatatcgcagtcttgccgtttccaccgcatgggcttaccaaacttatcga
cagcaatttggcgattcttacctaaccgatacccacagcctaacctcacgcgccgctgct
gtccactcaggaccaatcgtcaaagcgatcgctcgtaaagatggcgtgcaaatcgcagaa
aaactccacaatgatttagagcgtgtcgtgttaccagaatacccccaagtcgcacagcta
cgccaagtgtttcaagaagctggaggattaggcgcaatgatgtctggttcaggtcctaca
gtatttgctttgtgcgagtcgcatgaacaagcacaacaagtgcagcagtatgtcagaaag
gcaattcccgacccagatttggaattgtggttagcgcaaacatgtagtacaggtattcaa
gtcgccactagtgctaagtaa

DBGET integrated database retrieval system