KEGG   Gloeocapsa sp. PCC 7428: Glo7428_2636Help
Entry
Glo7428_2636      CDS       T02400                                 

Definition
(GenBank) succinyl-CoA synthetase (ADP-forming) beta subunit
  KO
K01903  succinyl-CoA synthetase beta subunit [EC:6.2.1.5]
Organism
glp  Gloeocapsa sp. PCC 7428
Pathway
glp00020  Citrate cycle (TCA cycle)
glp00640  Propanoate metabolism
glp00660  C5-Branched dibasic acid metabolism
glp01100  Metabolic pathways
glp01110  Biosynthesis of secondary metabolites
glp01120  Microbial metabolism in diverse environments
glp01130  Biosynthesis of antibiotics
glp01200  Carbon metabolism
Brite
KEGG Orthology (KO) [BR:glp00001]
 Metabolism
  Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    Glo7428_2636
   00640 Propanoate metabolism
    Glo7428_2636
   00660 C5-Branched dibasic acid metabolism
    Glo7428_2636
Enzymes [BR:glp01000]
 6. Ligases
  6.2  Forming carbon-sulfur bonds
   6.2.1  Acid-thiol ligases
    6.2.1.5  succinate---CoA ligase (ADP-forming)
     Glo7428_2636
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: ATP-grasp_2 ATP-grasp_5 Ligase_CoA
Motif
Other DBs
NCBI-ProteinID: AFZ31138
UniProt: K9XF80
Position
2950079..2951266
Genome map
AA seq 395 aa AA seqDB search
MDLLEYQAKEWFREMGIPVLPSQRIDRPSDIKRLKIPYPVVLKSQVRVGGRGRAGGVRFV
TNTIDAIAAAQTIFHLSILGELPEVLLAEAKYDADQEFYLAIVLDAAAHRPLLLGSPQGG
IDVESAPELLQQVVVDQEFSPFYARRLTIKMGLQGPLIQTVSGIIEKMYQLFVQKDLDLV
EINPLGVSSTGELMALDGKVSVNDRAIARHSDVAAMAEKMVQREKGRKYSLELGTWDEVD
PASNIGVLGNGAGLVMATMDLLSDAGSKPAICLNIGHGRSWNATTPSFSDRLQQGLEFLS
EQKNIQVVLVNILGTVPTPAELAQVIVNFVQRRERMTTSRSRTQSYSPRVIVRFAGAEID
AAKEQLATVQVSVAESLDEAVAQVSRFAKSSGRRK
NT seq 1188 nt NT seq  +upstreamnt  +downstreamnt
atggatctactagagtaccaagcaaaggaatggtttagggagatgggcatacctgtcttg
ccgtcgcaacgcattgaccgccctagcgacatcaaacggctcaaaattccttatcctgtg
gtacttaagtcgcaagtacgtgttggtggtcgaggtagggcaggaggagtgcgatttgtg
acgaatacaatcgatgcgatcgccgctgcgcaaacaatttttcatttatcaattttgggt
gaattacccgaagtcttgctcgcagaagccaaatacgacgcggatcaagagttttattta
gctatcgtcttagatgcagcggcgcatcgaccactacttttaggttctccccaaggtggt
attgatgtcgaatcagcacccgaactcttacagcaagtcgtcgttgaccaagaattttcg
ccattttatgcgcgacgcttaacgatcaaaatgggtctacaaggaccgctgattcagaca
gtcagtgggattatcgagaaaatgtatcagttgttcgtgcagaaagacctagacttggtg
gaaattaatcctctcggtgtcagttcgaccggagaacttatggcactcgatggtaaagtc
agcgtcaacgatcgcgcgatcgcgcgtcattctgatgtcgccgcgatggcggaaaaaatg
gtgcagcgcgagaaaggacgcaagtattcgctagaattaggtacttgggatgaagtcgat
ccggcaagcaatatcggggttttgggtaacggcgcgggtttagtcatggcgacgatggat
ttactcagcgatgcaggaagtaagccagcaatttgtctcaatattggacatggcagaagt
tggaatgcaacaacacctagctttagcgatcgcctgcaacaaggactcgaattcttgagc
gaacaaaaaaatattcaagtcgtgttagttaatattctcggtacagtgccaacccccgca
gaattagcccaagtgattgtgaattttgtgcaacgtcgagaacgaatgaccactagcaga
tcgcgcacgcaatcatactcgccacgcgtcattgtgcggtttgcaggtgcagagatagac
gccgcgaaagaacaacttgccacagtgcaagtctctgttgctgaaagtctagatgaagct
gtagcacaagtatcgcgttttgccaagtcctctggaagaagaaaatga

DBGET integrated database retrieval system