KEGG   Gloeocapsa sp. PCC 7428: Glo7428_2697Help
Entry
Glo7428_2697      CDS       T02400                                 

Definition
(GenBank) aspartate carbamoyltransferase
  KO
K00609  aspartate carbamoyltransferase catalytic subunit [EC:2.1.3.2]
Organism
glp  Gloeocapsa sp. PCC 7428
Pathway
glp00240  Pyrimidine metabolism
glp00250  Alanine, aspartate and glutamate metabolism
glp01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:glp00001]
 Metabolism
  Nucleotide metabolism
   00240 Pyrimidine metabolism
    Glo7428_2697
  Amino acid metabolism
   00250 Alanine, aspartate and glutamate metabolism
    Glo7428_2697
Enzymes [BR:glp01000]
 2. Transferases
  2.1  Transferring one-carbon groups
   2.1.3  Carboxy- and carbamoyltransferases
    2.1.3.2  aspartate carbamoyltransferase
     Glo7428_2697
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: OTCace_N OTCace
Motif
Other DBs
NCBI-ProteinID: AFZ31198
UniProt: K9XFD5
Position
3010995..3011984
Genome map
AA seq 329 aa AA seqDB search
MATTTWTRHHVLSLADFTPEEYDTVLQTAASFREVLSRRTKKVPTLQGQVVANLFFEPST
RTRSSFELAAKRLSADTLNFAASTSSLTKGETILDTAKTYLAMGTDMMVIRHREAGVPQA
IASEMDRLGVRVGVLNAGDGQHEHPSQALLDLFTICTLIDPDRPRLELLKDKKIAIVGDI
LHSRVARSNIWSLTASGAEVHLAAPPTLLPPLFAQFATDTPGKLFLHWQVEPALQNADFV
MTLRLQKERMTQYLLPSLREYHQHFGITRDRLRICQSDVKVLHPGPVNRGVEISSDLMDD
PQFSLIQTQVTSGVAVRMALLYLMGSSKA
NT seq 990 nt NT seq  +upstreamnt  +downstreamnt
atggcaaccacaacttggactcgtcatcacgttctttcgcttgcagatttcacgccggaa
gaatacgatacagtcttacaaaccgccgcaagctttcgtgaggtcttatcacggcggaca
aagaaagtcccaacattgcaaggacaagtggttgccaacttattttttgaaccatcgaca
cggactcgcagtagctttgaacttgcagccaaacgattatccgcagatacgcttaatttt
gccgcctccacgtcatcgttaaccaaaggcgaaacaattttagatactgcaaaaacgtat
ttggcgatgggaaccgatatgatggtgattcgccatcgcgaagccggagttccccaagcg
atcgcttcggaaatggatcgcctaggagtcagagttggagtattaaacgcgggtgacggt
caacacgaacatccttcgcaagcgttactggatttatttacaatatgtacgctaattgat
cccgaccgtccccgcttggaacttctaaaagacaaaaaaattgcaattgttggtgatatt
ctacactcacgcgtcgcaaggtcgaatatttggagcttaacagcaagcggtgccgaagtc
cacttagccgcaccaccgacactattaccgccgttgttcgcacaattcgctaccgacact
cctggtaagctatttttacattggcaagtcgaaccggcactgcaaaatgctgattttgtg
atgacactgcggttgcaaaaagaacgcatgacgcagtatttgttaccaagtttgcgcgaa
taccatcagcactttggcattacacgcgatcgcctgcggatttgtcaatctgatgttaaa
gtcctgcatccaggtcctgtgaatcgcggcgtcgaaattagttctgatctgatggacgat
ccgcaatttagcttaattcagacacaggtaacgagtggcgttgcggtgcggatggcgctg
ttatatcttatgggcagtagcaaagcttaa

DBGET integrated database retrieval system