KEGG   Gloeocapsa sp. PCC 7428: Glo7428_2736Help
Entry
Glo7428_2736      CDS       T02400                                 

Definition
agmatinase (EC:3.5.3.11)
Orthology
K01480  
agmatinase [EC:3.5.3.11]
Organism
glp  Gloeocapsa sp. PCC 7428
Pathway
Arginine and proline metabolism
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:glp00001]
 Metabolism
  Amino acid metabolism
   00330 Arginine and proline metabolism
    Glo7428_2736
Enzymes [BR:glp01000]
 3. Hydrolases
  3.5  Acting on carbon-nitrogen bonds, other than peptide bonds
   3.5.3  In linear amidines
    3.5.3.11  agmatinase
     Glo7428_2736
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
3056868..3057821
Genome map
AA seq 317 aa AA seqDB search
MVRVVFLLNSFVMLAQTSTAVTPFLGADVAADYAAAQVVILPIPYEATTTYRRGCETGPD
AILAASQQVEYYDEELDWETGLDVGIYTHPAIADTRSGAVTSEEMLQVTRETVFKLVRDG
KFVISLGGEHSITTGIVEAYRQAYPDESFTVVQIDAHGDLRHEYEGSIHNHACVMRRIVD
MKLPTVQIGIRAICKEEADLIKEKNLTVFRAREIAAQPNWIENAIAAIPTEKVFLTIDLD
GIDPTLIPGVGTPEPGGLNWYALTTFLCGVFDKHQVIGCDVMELAPVTDSVVSEFTAAKL
VYKLIGYHAKGRGASTR
NT seq 954 nt NT seq  +upstreamnt  +downstreamnt
atggttcgtgttgtgttcctgttaaactcatttgtcatgctggctcaaacttctacagcg
gttacaccttttttgggcgcagacgttgcggcggattatgctgcggcgcaggttgtcatt
ttaccaattccctacgaagcaacaacaacgtatcggcgtggctgtgaaaccggacctgat
gcaattctcgcagcttcgcagcaagtggaatactatgatgaggaactcgactgggaaacg
ggacttgatgtaggtatctacacgcatccagcgatcgcggatactagaagcggggctgtc
acctccgaggaaatgttgcaagttaccagagaaactgttttcaagctcgtgcgagatggc
aaatttgtcatttctttaggcggcgaacacagtattaccacaggcattgtggaggcgtac
cgccaagcgtatccagatgaatcatttaccgttgtgcaaattgacgcgcatggagatttg
cgccacgagtacgaaggctcgattcataaccatgcttgcgtgatgcgacggattgttgat
atgaaattaccaacggttcaaattggcattcgggcgatttgtaaagaagaagctgatctg
atcaaagaaaaaaatctcaccgtgtttcgcgcgcgagaaattgccgcacaaccaaattgg
atcgaaaatgcgatcgccgcaattcccacagaaaaggtatttctgacgattgacttagat
ggcatcgaccccacactgattcctggtgttggaactcctgaacctggtggtttgaattgg
tacgcactgacaacatttctgtgtggcgtctttgacaaacatcaagtcattggctgtgat
gtgatggaattagccccagtgactgattcagtcgtttcagaatttaccgccgctaagctt
gtttacaaactcattggctatcacgcaaaggggcgaggagcgagtacaagatag

DBGET integrated database retrieval system