KEGG   Gloeocapsa sp. PCC 7428: Glo7428_2847Help
Entry
Glo7428_2847      CDS       T02400                                 

Definition
UDP-N-acetylmuramoylalanyl-D-glutamate--2,6-diaminopimelate ligase (EC:6.3.2.13)
Orthology
K01928  
UDP-N-acetylmuramoyl-L-alanyl-D-glutamate--2,6-diaminopimelate ligase [EC:6.3.2.13]
Organism
glp  Gloeocapsa sp. PCC 7428
Pathway
Lysine biosynthesis
Peptidoglycan biosynthesis
Class
Metabolism; Amino acid metabolism; Lysine biosynthesis [PATH:glp00300]
Metabolism; Glycan biosynthesis and metabolism; Peptidoglycan biosynthesis [PATH:glp00550]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
3187099..3188619
Genome map
AA seq 506 aa AA seqDB search
MKLRELLKNIASVVEVPQHAAIDTEVTGLKTNSHACQAGDLFIGMPGTRVDGGEFWQSAI
ASGAIAALISTDAAKKQPVTTDACVIVATDMVEACASSAAAFYGYPAKQLKLVGVTGTNG
KTTTTHLIEFFLTQAQFPTALMGTLYTRWQGYEQTATHTTPFAVELQQQLAAARDAGCQW
GVMEVSSHALAQGRVMGCPFEVGVFTNLTQDHLDFHKDMEDYFAAKALLFSPDYLQGRAV
INADDAYGQRLIAQIPAQQLWRYSVHNAEGSDFWTSDLNYEPTGVSGMLHTPKGDIAFRS
PLVGEYNLSNMLASVAAALHLGVDLELIAQALPKFTEVPGRMERVQIDAKQDISVIVDYA
HTPDSLENLLKASRPFIPGKMICVFGCGGDRDRTKRPKMGAIAAQLADIAVVTSDNPRTE
DPERILQDILAGIPKTVQPKVIGDRASAIRTAILEAQPGDGVLIAGKGHEDYQILGTEKI
HFDDREQARFALQERHNAQMMQGSGG
NT seq 1521 nt NT seq  +upstreamnt  +downstreamnt
atgaaattgcgcgaattgttgaaaaatattgcaagtgttgtcgaagtaccccaacacgca
gcaatcgatacggaagttacggggttaaaaacaaactctcatgcttgtcaagcaggagat
ctgtttattggaatgccagggacgcgagttgatggcggcgaattttggcaaagtgcgatc
gcatcgggcgcgatcgccgcgttaatttccaccgatgcggcaaaaaaacagcccgtgaca
acggatgcttgtgtcattgtggcaactgatatggtagaagcctgcgcctcttcggctgcg
gctttttatggctaccctgcaaaacaactcaaacttgtaggggtgacgggtacgaatggc
aaaacgacaacaacgcacctcattgaattttttctgacgcaagcgcaatttcccactgca
ttgatgggaactctctacacgcgatggcaaggttatgagcaaaccgcaacgcacactaca
cccttcgccgtcgaacttcagcagcaactagccgcagcccgtgacgcgggttgtcagtgg
ggcgtgatggaagtgagttcccatgctttagcccaagggcgggtgatgggctgtccgttt
gaagttggggtgttcacaaatttaacgcaagaccaccttgacttccacaaggatatggaa
gattattttgcggcgaaagcactgttatttagccctgattatcttcaaggacgcgcggtg
attaatgcggatgatgcttacggacaaagactcattgcacaaatacctgcgcagcaacta
tggcgctatagcgtccacaatgcggagggatctgatttttggacgagcgatctaaactat
gaaccgacgggtgtgagtggaatgctgcatacacccaaaggagatattgcgtttcgttcg
cctttagtcggcgagtacaacctttcaaatatgttggcatctgttgccgcagcgttacac
ctgggtgtagatttagaattaattgcccaagctttaccaaaatttacggaagttcctggg
cggatggaacgcgtgcaaatcgatgccaagcaagatattagcgtgattgtcgattacgcg
cacacacctgatagtttagaaaatttactcaaagcctcgcgaccgtttattccaggtaag
atgatctgcgtgtttggttgtggtggcgatcgcgatcgcacgaagcgtccgaaaatggga
gcaattgccgcgcaacttgcagatatcgcggttgtcacgtcagataacccgcgtactgaa
gaccccgaacgcattttgcaagatattttagccggaattcccaaaaccgtacagccaaaa
gtaatcggcgatcgcgcgagtgcgattcgtacagcgatcctcgaagcccaaccaggagat
ggcgtacttattgcggggaaaggtcacgaagactaccaaattttaggaacagaaaaaatc
cactttgacgatcgcgaacaagcaagatttgctttgcaagaaagacacaacgcccaaatg
atgcaagggagtggtggttag

DBGET integrated database retrieval system