KEGG   Gloeocapsa sp. PCC 7428: Glo7428_2908Help
Entry
Glo7428_2908      CDS       T02400                                 

Definition
1,4-alpha-glucan-branching enzyme (EC:2.4.1.18)
Orthology
K00700  
1,4-alpha-glucan branching enzyme [EC:2.4.1.18]
Organism
glp  Gloeocapsa sp. PCC 7428
Pathway
Starch and sucrose metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:glp00001]
 Metabolism
  Carbohydrate metabolism
   00500 Starch and sucrose metabolism
    Glo7428_2908
Enzymes [BR:glp01000]
 2. Transferases
  2.4  Glycosyltransferases
   2.4.1  Hexosyltransferases
    2.4.1.18  1,4-alpha-glucan branching enzyme
     Glo7428_2908
Exosome [BR:glp04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   Glo7428_2908
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(3258624..3260915)
Genome map
AA seq 763 aa AA seqDB search
MSMTIAPEQVERIVWNQHDDPFEVLGSHPIEQDGKTVWVVRAYLPNASAAWVIRPEARIE
HQMHPVHHPHFFECTIDVSELANYQLKIKEGEHERVIYDPYAFRSPKLTDFDLHLFSEGN
HHRIYEKLGAHLTEVDGVKGVYFAVWAPNARNVSILGDFNSWDGRKHQMRKGVTGIWELF
IPEITVGDRYKYEIKNFDGHIYEKSDPYGFQQEVRPKTASIVADLEAYAWNDAEWMEQRR
HTDTLTQPISVYEVHLGSWLHAASAEPAKLPNGETEPVVPVSELQPGARFLTYRELAAKL
IPYVKDLGYTHVELLPIAEHPFDGSWGYQVTGYYACTSRYGSPEDFMYFIDQCHQNGIGV
IVDWVPGHFPKDGHGLAFFDGTHLYEHADPRKGEHKEWGTLVFNYSRHEVRNFLVANALF
WFDKYHIDGIRVDAVASMLYLDYCRKEGEWLPNQYGGRENIEAAEFLRQTNHVIFSYFPG
ILSIAEESTDWPMVSWPTYTGGLGFNLKWNMGWMHDMLDYFSMDPWFRQFHQNNITFSMW
YHHSENFMLALSHDEVVHGKSNIIGKMPGDRWQKFASVRCLFTYMFAHPGKKTLFMGMEF
GQWSEWNVWGDLEWHLLQYEPHQQLKRFMKDLNHLYRAEPALYTQDFGQAGFEWIDCSDN
RHSVVSFIRRGKDPEDFVIVVCNFTPQPHSHYRIGVPEFGFYTEIFNSDAREYGGSNMGN
LGGKWAEEWSYHNHSYSIDLCLPPLGVLILKLDGEKTAQALRK
NT seq 2292 nt NT seq  +upstreamnt  +downstreamnt
atgtctatgaccatcgccccagaacaggttgagcgcattgtctggaatcagcatgacgat
ccgtttgaagtgcttggttctcatcccatagaacaagatggcaaaaccgtgtgggtggtg
cgagcttatttaccaaacgcgagtgcagcatgggtgattcgtccagaagcacgaattgaa
catcaaatgcatccggtgcatcatccccatttctttgagtgtacgatcgacgtttcagaa
ttagcaaactaccaattaaaaatcaaagaaggcgaacacgaacgggtaatatacgaccca
tatgcttttcgttcgccaaagttaactgattttgatctgcatttattttccgaagggaac
caccaccgcatttatgaaaaactaggggcgcatctgactgaagttgatggtgttaaaggc
gtttattttgcggtttgggcaccgaatgcgcggaatgtgtcaatccttggagattttaat
tcctgggatggacggaagcatcaaatgcgtaaaggcgtaacgggcatttgggaattgttt
attccagaaatcacagtaggcgatcgctacaaatacgaaattaaaaacttcgacgggcac
atctacgaaaaatccgacccctacggttttcaacaagaagttcgccccaaaaccgcctca
attgtcgccgatcttgaggcttacgcgtggaacgatgcagaatggatggagcagcggcgt
catacagataccttaacgcagcctatttcagtttacgaagttcatttaggttcgtggtta
cacgctgcctcggcagaaccagctaaactccctaatggagaaactgaaccagtcgttccg
gtttctgaactccaaccaggggcgcgatttctgacttatcgcgaacttgcggctaaacta
attccttacgttaaagacttgggctacacgcacgttgaactgctaccgatcgcggaacat
ccgtttgatggttcgtggggttatcaagtcacgggttattatgcttgtacttcgcgctat
ggcagccctgaagattttatgtacttcatcgaccaatgccatcaaaatggaattggtgtg
attgttgattgggtaccaggtcactttccgaaagatggtcatggtttagcattttttgac
ggtacgcatctttacgaacacgccgatccccgcaaaggcgaacacaaagagtggggaacg
ttagtttttaactatagccgccatgaagtgagaaactttttagtcgccaacgctttattt
tggtttgataagtatcacatcgatggtattcgagttgatgcagttgcgtcgatgctgtac
ctcgattattgccgtaaagaaggcgaatggctgcctaaccagtatggtggacgagaaaat
atcgaagctgctgagtttctgcgccaaacaaatcacgtaattttcagttactttcctggc
attctctcaattgcagaagagtctaccgattggccaatggtatcttggccgacatacaca
ggaggattgggctttaatttaaagtggaacatgggttggatgcacgatatgctggattat
ttcagcatggacccttggttccggcaatttcatcaaaacaatatcacgtttagtatgtgg
tatcaccacagcgaaaacttcatgctggcgctgtcacacgatgaagtggtacacggcaag
agcaatatcattggtaaaatgccaggcgatcgctggcagaagtttgcaagcgtgcgctgt
ttgtttacgtatatgtttgcgcatcctggcaagaaaacgctgtttatggggatggagttt
ggacagtggagcgagtggaatgtgtggggcgatttggagtggcacttgttgcagtatgaa
ccgcaccaacagctaaagcgattcatgaaggatctcaaccatctctaccgcgctgaacca
gctttatacacgcaagatttcgggcaagcaggatttgaatggattgactgtagcgacaac
cgtcatagtgttgtttccttcattcgtcgtggaaaagatcctgaagattttgtcattgtg
gtttgtaatttcacccctcaaccgcattcgcattatcgaattggtgtcccagagtttgga
ttctatactgaaatctttaacagtgatgcccgcgagtatggtggtagcaatatgggaaat
ttaggtggtaagtgggctgaggaatggtcttatcacaatcactcttactcaattgatcta
tgtctaccacctttaggtgtacttattctaaaactcgatggcgagaaaacggcgcaagcg
ttgcgtaagtaa

DBGET integrated database retrieval system