KEGG   Gloeocapsa sp. PCC 7428: Glo7428_3016Help
Entry
Glo7428_3016      CDS       T02400                                 

Definition
Alkaline phosphatase (EC:3.1.3.1)
Orthology
K01113  
alkaline phosphatase D [EC:3.1.3.1]
Organism
glp  Gloeocapsa sp. PCC 7428
Pathway
Aminobenzoate degradation
Folate biosynthesis
Metabolic pathways
Microbial metabolism in diverse environments
Two-component system
Class
Metabolism; Metabolism of cofactors and vitamins; Folate biosynthesis [PATH:glp00790]
Metabolism; Xenobiotics biodegradation and metabolism; Aminobenzoate degradation [PATH:glp00627]
Environmental Information Processing; Signal transduction; Two-component system [PATH:glp02020]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
3374177..3375751
Genome map
AA seq 524 aa AA seqDB search
MARWDVERLLLTGMQRRRLLIGVSALTSLAIASQFSRRVVAQPKFSDYPFKLGVASGEPL
PDGFVIWTRLAPQPLNGGGMPRQNIEVRWQVARDPKMQQVVQKGTAIATPELAHSVHVEV
QGLEPNRWYWYQFKVGNDTSRIGRTRTAPARGDRLQQLTFAFASCQDWQNGFYSAYRNMA
REELDFVVHLGDYIYEYGPDFSKPRQHNSAEIISLVDYRNRHALYKTGFHLQAVHAKFPW
IVTWDDHEVDNNYANFIPEDDQTREEFIQRRANAYQAYYEHMPLRLSSLPKGPDMQLYRR
LTFGDLAEFFVLDTRQYRSDQPCGDGLKPRCAEALAEKATMTGKEQERWLFKGLERSPAR
WNVIAQQTMMAQFDFDARSDSETFNLDQWDGYVAARDRLFHFIQQRKVANPVVITGDIHS
SWIHDLKADFNNPASPTIGTEFVGTSITSDFPTQFIAPVTAALADNPHTKFFDGAFRGYV
RCQLTPKQWRSDYRVVSSILDPQAPASTLASFIVENGHPGAQNA
NT seq 1575 nt NT seq  +upstreamnt  +downstreamnt
atggctcgttgggatgtggagcgtttgctgttgactgggatgcagcggcgacgcttgctg
atcggtgtgagtgcattaacaagtttggcgatcgcaagtcaattttcgcggcgagtcgtt
gctcaaccaaaattttctgattatcccttcaaacttggtgtcgcttcaggagaaccatta
cccgatggttttgtgatttggacgcggttagcacctcaacccctcaacggtgggggaatg
ccaaggcagaatattgaagtgcgctggcaagtagcacgagatcccaaaatgcagcaagtt
gtccaaaaaggaacggcgatcgcaactcctgaacttgcgcattcggttcatgtcgaagtg
caaggtttagaaccaaatcgctggtattggtatcaattcaaagtaggtaacgatacaagt
cgcatcggcagaacgcgcactgcacctgcaagaggcgatcgcttacaacaactgactttt
gcgtttgcttcatgtcaagattggcaaaatggtttttattctgcctaccgcaacatggcg
cgagaagaactcgattttgtcgtccatctcggcgattatatttacgaatacggacctgat
tttagcaaaccacgccaacacaacagcgctgaaattatcagccttgtagattaccgcaat
cgtcatgctttgtacaaaaccggatttcacttacaagcggttcatgcaaagtttccttgg
attgtcacttgggacgatcacgaagttgataataattacgccaacttcattcccgaagac
gatcaaacgcgcgaagagtttattcaacgtcgtgccaatgcttaccaagcttattacgag
catatgccattgcgtttatcttccttgcccaaaggtcccgatatgcaactttatcggcgt
ttgacttttggtgatttagcagagttttttgtcttagatacccgccaataccgcagcgat
cagccgtgtggagatggcttaaaacctcggtgcgcggaggctttggcagaaaaggcgacg
atgacgggtaaagaacaagaacgctggttatttaaaggattagagcgatcgcccgcgcgt
tggaatgtgattgcccaacaaacaatgatggctcaatttgactttgatgcgcgttcagat
agtgaaacgtttaacctcgatcaatgggatggctacgttgccgcacgcgatcgcctgttt
cacttcatccaacaacgcaaagtggctaaccctgttgtgattacaggtgacattcactct
agctggatacacgatctcaaagccgactttaacaatcctgcttcacctaccatcggtaca
gaatttgtcggaacttcgattacttcggattttcctacgcagtttatcgccccagtcacc
gcagctttagccgataatccacatactaagtttttcgacggtgcttttcgcggctacgtt
cgctgtcaacttacacctaaacaatggcgtagcgattatcgagttgtttcatcaattctc
gacccacaagctccagcgagtacgctagcgtcgttcattgtcgaaaatggacatccaggc
gctcaaaatgcataa

DBGET integrated database retrieval system