KEGG   Gloeocapsa sp. PCC 7428: Glo7428_3260Help
Entry
Glo7428_3260      CDS       T02400                                 

Definition
catalytic domain-containing protein of components of various dehydrogenase complexes
Orthology
K00627  
pyruvate dehydrogenase E2 component (dihydrolipoamide acetyltransferase) [EC:2.3.1.12]
Organism
glp  Gloeocapsa sp. PCC 7428
Pathway
Glycolysis / Gluconeogenesis
Citrate cycle (TCA cycle)
Pyruvate metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Carbon metabolism
Module
Pyruvate oxidation, pyruvate => acetyl-CoA
Class
Metabolism; Overview; Carbon metabolism [PATH:glp01200]
Metabolism; Carbohydrate metabolism; Glycolysis / Gluconeogenesis [PATH:glp00010]
Metabolism; Carbohydrate metabolism; Citrate cycle (TCA cycle) [PATH:glp00020]
Metabolism; Carbohydrate metabolism; Pyruvate metabolism [PATH:glp00620]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
3614293..3615618
Genome map
AA seq 441 aa AA seqDB search
MIHEIFMPALSSTMTEGKIVSWVKSPGDKVEKGETVVVVESDKADMDVESFYEGYVATIL
VEAGDSAPVGSAIALLAETEAEIETAKQQAQSGGATQSEADTTTSPGQIADVSTTVAATA
ADTAEASSNGNGAAHRAGRVMVSPRARKLAKELKVDLSNLQGSGPHGRIVAQDIEAAAGK
TQPTPAAQPQIKAPVAPPPTPTVKSAPAPAPAPVATAAPGQVVPLNTLQNAVVRNMVASL
QVPTFHVGYTITTNELDKLYKQIKSKGVTMTALLAKAVAVTLQKHPLVNASYSEQGIQYR
SAINIAVAVAMDDGGLITPVLQNADQIDIYSLSRNWKSLVDRARLKQLQPEEYNSGTFTL
SNLGMFGVDRFDAILPPGQGAILAVGAARSQVVAIDGMFGVRQQMQVNITCDHRIIYGAH
AAAFLQDLAKLIETNPQSLTM
NT seq 1326 nt NT seq  +upstreamnt  +downstreamnt
atgattcacgaaatatttatgcctgcgcttagctcgactatgactgaagggaaaattgtc
tcttgggtcaaatcgcctggtgacaaagtggaaaaaggcgaaacagtggtagttgtcgaa
tccgacaaagctgatatggatgtcgaatccttttatgaaggttacgtggcgacaatttta
gtagaagcaggtgatagcgctcccgttggttcggcgatcgcgcttttggctgaaaccgaa
gctgaaattgaaactgccaagcaacaagctcaatctggcggcgctacgcagtctgaagcc
gatacgacaacctcaccagggcaaattgcagatgtttcaacgacggttgcagcaactgcg
gctgacactgctgaagcctcctcaaatggaaatggtgcagcacatcgtgccggacgcgtg
atggtttcgccacgggcacggaaactcgccaaagaactcaaagttgacttgagtaatctg
caaggtagtggtcctcacggtcgaattgtggcacaagatatcgaagcagcagcaggtaaa
acccaaccgacaccagccgcacaaccgcaaatcaaggctcctgtcgcaccaccacccaca
ccaacggttaaaagcgctcctgcacccgcaccagcccccgtcgctactgctgcaccaggt
caagtcgtacctttgaatacgctgcaaaatgccgtagtgcggaacatggtagcaagttta
caagtgcctaccttccacgtcggctacacgattacgaccaatgaattagataagctgtac
aagcagattaagtctaagggcgtgacgatgactgcgctgttggcgaaagctgttgctgtg
acgttgcagaaacatccgctggtaaacgccagctattcggaacaaggtattcaatatcgt
agtgcgattaacattgctgttgctgtggcgatggatgatggtgggttaatcaccccagta
ttgcaaaatgccgaccaaattgatatttattcactatcacgtaattggaaatcgctagtt
gaccgcgctcgtctgaagcaactacaacctgaagaatacaacagcggtactttcacgttg
tccaatttggggatgtttggggtcgatcggtttgatgcgattttaccaccaggtcaagga
gcgattcttgcggtaggtgctgcgcgatcgcaagttgtcgcgatcgatggaatgttcggt
gtgcggcagcaaatgcaagtcaatattacgtgcgaccaccgtatcatatatggcgcgcac
gcggctgcctttttacaagatttagcgaagttgattgagacaaatccccaatcgctcaca
atgtaa

DBGET integrated database retrieval system