KEGG   Gloeocapsa sp. PCC 7428: Glo7428_3260Help
Entry
Glo7428_3260      CDS       T02400                                 

Definition
catalytic domain-containing protein of components of various dehydrogenase complexes
Orthology
K00627  
pyruvate dehydrogenase E2 component (dihydrolipoamide acetyltransferase) [EC:2.3.1.12]
Organism
glp  Gloeocapsa sp. PCC 7428
Pathway
Glycolysis / Gluconeogenesis
Citrate cycle (TCA cycle)
Pyruvate metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Carbon metabolism
Module
Pyruvate oxidation, pyruvate => acetyl-CoA
Brite
KEGG Orthology (KO) [BR:glp00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    Glo7428_3260
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    Glo7428_3260
   00020 Citrate cycle (TCA cycle)
    Glo7428_3260
   00620 Pyruvate metabolism
    Glo7428_3260
Enzymes [BR:glp01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.12  dihydrolipoyllysine-residue acetyltransferase
     Glo7428_3260
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
3614293..3615618
Genome map
AA seq 441 aa AA seqDB search
MIHEIFMPALSSTMTEGKIVSWVKSPGDKVEKGETVVVVESDKADMDVESFYEGYVATIL
VEAGDSAPVGSAIALLAETEAEIETAKQQAQSGGATQSEADTTTSPGQIADVSTTVAATA
ADTAEASSNGNGAAHRAGRVMVSPRARKLAKELKVDLSNLQGSGPHGRIVAQDIEAAAGK
TQPTPAAQPQIKAPVAPPPTPTVKSAPAPAPAPVATAAPGQVVPLNTLQNAVVRNMVASL
QVPTFHVGYTITTNELDKLYKQIKSKGVTMTALLAKAVAVTLQKHPLVNASYSEQGIQYR
SAINIAVAVAMDDGGLITPVLQNADQIDIYSLSRNWKSLVDRARLKQLQPEEYNSGTFTL
SNLGMFGVDRFDAILPPGQGAILAVGAARSQVVAIDGMFGVRQQMQVNITCDHRIIYGAH
AAAFLQDLAKLIETNPQSLTM
NT seq 1326 nt NT seq  +upstreamnt  +downstreamnt
atgattcacgaaatatttatgcctgcgcttagctcgactatgactgaagggaaaattgtc
tcttgggtcaaatcgcctggtgacaaagtggaaaaaggcgaaacagtggtagttgtcgaa
tccgacaaagctgatatggatgtcgaatccttttatgaaggttacgtggcgacaatttta
gtagaagcaggtgatagcgctcccgttggttcggcgatcgcgcttttggctgaaaccgaa
gctgaaattgaaactgccaagcaacaagctcaatctggcggcgctacgcagtctgaagcc
gatacgacaacctcaccagggcaaattgcagatgtttcaacgacggttgcagcaactgcg
gctgacactgctgaagcctcctcaaatggaaatggtgcagcacatcgtgccggacgcgtg
atggtttcgccacgggcacggaaactcgccaaagaactcaaagttgacttgagtaatctg
caaggtagtggtcctcacggtcgaattgtggcacaagatatcgaagcagcagcaggtaaa
acccaaccgacaccagccgcacaaccgcaaatcaaggctcctgtcgcaccaccacccaca
ccaacggttaaaagcgctcctgcacccgcaccagcccccgtcgctactgctgcaccaggt
caagtcgtacctttgaatacgctgcaaaatgccgtagtgcggaacatggtagcaagttta
caagtgcctaccttccacgtcggctacacgattacgaccaatgaattagataagctgtac
aagcagattaagtctaagggcgtgacgatgactgcgctgttggcgaaagctgttgctgtg
acgttgcagaaacatccgctggtaaacgccagctattcggaacaaggtattcaatatcgt
agtgcgattaacattgctgttgctgtggcgatggatgatggtgggttaatcaccccagta
ttgcaaaatgccgaccaaattgatatttattcactatcacgtaattggaaatcgctagtt
gaccgcgctcgtctgaagcaactacaacctgaagaatacaacagcggtactttcacgttg
tccaatttggggatgtttggggtcgatcggtttgatgcgattttaccaccaggtcaagga
gcgattcttgcggtaggtgctgcgcgatcgcaagttgtcgcgatcgatggaatgttcggt
gtgcggcagcaaatgcaagtcaatattacgtgcgaccaccgtatcatatatggcgcgcac
gcggctgcctttttacaagatttagcgaagttgattgagacaaatccccaatcgctcaca
atgtaa

DBGET integrated database retrieval system