KEGG   Gloeocapsa sp. PCC 7428: Glo7428_3541Help
Entry
Glo7428_3541      CDS       T02400                                 

Definition
glycoside hydrolase family 8
Orthology
K01179  
endoglucanase [EC:3.2.1.4]
Organism
glp  Gloeocapsa sp. PCC 7428
Pathway
Starch and sucrose metabolism
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:glp00001]
 Metabolism
  Carbohydrate metabolism
   00500 Starch and sucrose metabolism
    Glo7428_3541
Enzymes [BR:glp01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.4  cellulase
     Glo7428_3541
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(3912408..3913697)
Genome map
AA seq 429 aa AA seqDB search
MQQLAQGKSQIQNTSFLPLSSALAVIVAVIGLSGCFSGSSVEQSELPLHSTPITTPSQSP
VVTSATAIDLDNLLQESWNAYRQRFIQADGRVIDREDSDRSTSEAQAYAMLRAVFADDPT
TFARTLNWSENNLQRTVAGKRTDQLWAWKWGRDAQGNWGISDRNFASDADIDAITALIFA
SRRWQRPDYLQLAQSKLQDLWNLSTVAVLQGHRYLIPGPTVAFQERSHLLILNPSYFAPY
AFRIFAQVDPARDWLSLVDSSYQALEDSAKLSRVNLPSDWVILDTQTGDYQALPVSHSLR
TEYSFNAYRVWWRLAWDAVWFQEPRATQFLQNHLKPLQQTWRSTNRIPAQIDLQGNPLVN
YEAASQYAMLYAAFRLIAPAIATEILQQKLLPQYQGGIWEQDSAYYTQNLVGLGLLPPTE
LTQLLQPTK
NT seq 1290 nt NT seq  +upstreamnt  +downstreamnt
atgcagcaactcgctcaaggtaaaagtcagattcaaaatacgagctttttgcctttgagt
tctgcacttgctgttattgttgctgtcattgggttaagcggttgtttttctggttcgtca
gtagaacaatccgagttaccactgcatagcacgccaataacgacgccatctcaatcgcct
gttgtcacctctgctacagcgatcgacttggacaatttattgcaagaaagctggaatgct
tatcggcaaaggtttattcaagctgatgggcgagtaattgatcgggaagatagcgatcgc
tctacctcagaagctcaagcctatgccatgctgcgggcagtgtttgcggacgatccaacg
acatttgctcgtacgctcaattggagcgaaaacaacctccagcgtactgtggctggtaaa
cgcacggatcagttatgggcatggaaatggggtcgtgatgcgcaaggaaattggggaatt
agcgatcgcaattttgcaagtgatgccgatattgatgcgattacggcattaatttttgca
tcgcgccgttggcaacgtcctgattatctacagttagcacaaagtaagctgcaagattta
tggaacttgtctaccgttgccgttttgcaaggacatcgttatctcatcccaggtcctacc
gttgcctttcaagagcgatcgcacctgctcattctcaatccttcttactttgcaccttac
gcatttcggatttttgcgcaagttgatcctgcgcgtgattggctatcgcttgtagatagc
agttaccaggcgttagaggattctgccaaattatctagagtgaatttaccgagcgattgg
gtcattctagatacgcaaacaggtgactatcaagcactacctgtatcgcattcattacga
accgaatacagttttaatgcgtatcgagtttggtggcgtttggcttgggatgcagtttgg
tttcaagaaccacgagcaactcaatttttacaaaatcacctcaagcctcttcaacaaacg
tggcgttccacaaaccgaattccagcacaaatcgatttgcaaggaaatccgttagtcaat
tacgaggcagcgtcgcagtatgccatgctctatgctgcctttcgcttgattgcgccagca
attgcaactgagattctgcaacaaaaacttttaccgcagtatcaaggtggcatttgggag
caggattccgcttactacacgcaaaacctggtgggattggggttacttccgcctaccgag
ttaacacaacttttacaacctaccaaatag

DBGET integrated database retrieval system