KEGG   Gloeocapsa sp. PCC 7428: Glo7428_3552Help
Entry
Glo7428_3552      CDS       T02400                                 

Definition
Histidinol dehydrogenase (EC:1.1.1.23)
Orthology
K00013  
histidinol dehydrogenase [EC:1.1.1.23]
Organism
glp  Gloeocapsa sp. PCC 7428
Pathway
Histidine metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Biosynthesis of amino acids
Class
Metabolism; Overview; Biosynthesis of amino acids [PATH:glp01230]
Metabolism; Amino acid metabolism; Histidine metabolism [PATH:glp00340]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
3934837..3936177
Genome map
AA seq 446 aa AA seqDB search
MLRIITQQAEVRAELQRICDRTHDDQVVHKEATVREVLQAVKRQGDRALLHYTAEFDHQN
LKQEELRVSGSELDAAYQQVSKELLDAIRLACRQIEAFHRQRVPKSWVHFGDDDVVLGKR
YTPVDRAGLYVPGGRAAYPSTVLMNAIPAKVAGVPRRIMVTPPGVGKSINPAVLVAAQEA
GVEEIYRVGGAQAIAALAYGTETIPKVNIITGPGNIYVTLAKKLVYGTVGIDSLAGPSEV
LVIADETANATYVAADLLAQAEHDPMAAAILLTTDAELAKKVQAEVERQLENHPRKTLTE
KAIAHYGLIVIVDSLEQAAELSNEFAPEHLELEIAEPWELLEKIRHAGAIFLGSSTPEAV
GDYLAGPNHTLPTSGAARYASALGVETFLKHSSLIQYSPLALQKVAGAIEVLAKAEGLPS
HAASVRLRTQPKSDTWGMEDGEKPKS
NT seq 1341 nt NT seq  +upstreamnt  +downstreamnt
atgctgcgaattattactcagcaagccgaggtacgagcagagctacaacgcatctgcgat
cgcacccacgatgaccaagtggttcacaaagaagcgacggtgcgggaagtgcttcaagca
gtgaagcgccaaggcgaccgagccttactgcactacacagcagaatttgaccaccaaaac
ctcaaacaagaagagctacgcgttagcggttcagaattagatgcggcttaccagcaagtg
tcgaaagaactgctcgatgcgattcggctcgcttgtcgtcaaatcgaagcatttcaccgc
caacgagtccccaaatcatgggttcattttggcgacgatgatgttgtcttgggcaaacgc
tacacgcctgtagacagagcagggttgtatgtgcctggtggtagagccgcatacccaagc
acggtgctgatgaatgcgattccggcaaaagtggcaggagtcccacggcgaattatggtg
acgccgccaggcgtaggcaaatcaatcaaccccgcagtattagtcgcggcgcaagaagct
ggagtagaagaaatttatcgcgtaggaggggcgcaggcgatcgcggcattagcgtatggc
acagaaacgatacccaaggtaaatattattacaggaccaggtaatatctatgtcaccttg
gcaaaaaaactcgtctatggaactgtcgggattgactcgctagccggaccttctgaggta
ctggtaattgctgacgaaaccgcgaacgcgacttatgtcgccgctgacttgttagcgcaa
gccgaacacgatcccatggcagcggcaattttgttgacgacggatgcggagttagccaag
aaagtacaagctgaagtcgagcgacaactcgaaaatcatccgcgcaaaacgttaaccgaa
aaagcgatcgcgcattatggcttaattgtgattgtcgattcgctagagcaagctgcggaa
ctttcaaatgagtttgcgccagaacatttagaactcgaaatcgcagaaccttgggagttg
ctagaaaaaattcgtcatgctggggcaattttcttaggttcatctacaccagaagctgta
ggagactatttagcaggaccaaaccacacgctacctacttcaggagccgcacgttatgcg
tcagctttaggtgtggagactttcttaaaacactctagcctcattcagtattcaccgctc
gcgcttcaaaaagtggcaggggcaatcgaagtcctcgccaaagctgaaggattgccatct
catgctgcatcggtacggttaaggacgcagcccaaaagtgatacttggggaatggaagat
ggggaaaagccaaagtcttaa

DBGET integrated database retrieval system