KEGG   Gloeocapsa sp. PCC 7428: Glo7428_3909Help
Entry
Glo7428_3909      CDS       T02400                                 

Definition
(GenBank) Glutathione S-transferase domain protein
  KO
K11209  
GSH-dependent disulfide-bond oxidoreductase [EC:1.8.4.-]
Organism
glp  Gloeocapsa sp. PCC 7428
Brite
Enzymes [BR:glp01000]
 1. Oxidoreductases
  1.8  Acting on a sulfur group of donors
   1.8.4  With a disulfide as acceptor
    1.8.4.-  
     Glo7428_3909
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
UniProt: 
Position
4348381..4349088
Genome map
AA seq 235 aa AA seqDB search
MIDLYYWTTPNGHKITMFLEEAELPYTLIPVNIGTGDQFKPDFLKIAPNNRIPAIVDRAP
ADGGEPISVFESGAILLYLAEKTGKLIATDIRQRAEVLQWLFWQMGGLGPMAGQNHHFSQ
YAPEKIPYAIDRYVNETGRLYAVMNKRLSDRTFLAGNNYSIADIAAYPWIVPYERQGQKL
ENFPHLQRWFEAIKARPATIRAYEKAEAFKDQALDIEKSRNLLFNQSANTIQQKS
NT seq 708 nt NT seq  +upstreamnt  +downstreamnt
atgattgacctttattactggacaacgcccaacggtcacaaaatcacaatgtttctagag
gaagctgaacttccttacacgctcattcctgtcaatattggtacgggagatcagtttaaa
cccgattttcttaaaattgccccaaataatcgcattcctgcaattgtcgatcgcgcccca
gcagatggcggcgaacccatttcagtgtttgaatcaggagcaattttgctgtatttagcc
gaaaaaacgggaaaactgattgcaacagatatccgccaacgtgctgaagttttgcaatgg
ttattttggcaaatgggcggtttaggaccaatggcagggcaaaatcatcattttagtcag
tatgcacctgaaaaaattccttatgcaatagaccgctacgttaatgaaacagggcgcttg
tatgcagtcatgaataaacggttaagcgatcgcacttttctggcaggtaataactactca
atcgcagatattgctgcttatccgtggattgtaccgtatgaacgccaaggacaaaagcta
gagaatttccctcatttgcagcgctggtttgaagcgattaaagcacgtccggcaacaatt
cgtgcttacgagaaagcagaagcatttaaagatcaagcactcgatatcgagaagtcacga
aacttgttgtttaaccaatcagcaaacacaattcagcaaaaaagctaa

DBGET integrated database retrieval system