KEGG   Gloeocapsa sp. PCC 7428: Glo7428_4095Help
Entry
Glo7428_4095      CDS       T02400                                 

Definition
Protein-arginine deiminase (EC:3.5.3.15)
Orthology
K01481  
protein-arginine deiminase [EC:3.5.3.15]
Organism
glp  Gloeocapsa sp. PCC 7428
Brite
Enzymes [BR:glp01000]
 3. Hydrolases
  3.5  Acting on carbon-nitrogen bonds, other than peptide bonds
   3.5.3  In linear amidines
    3.5.3.15  protein-arginine deiminase
     Glo7428_4095
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(4561720..4563732)
Genome map
AA seq 670 aa AA seqDB search
MREILQIETSAKVYSRSQKESREYEDILVVGQPAQISLEHIAPSEDASISFKVQGEIEIY
SNINQLVDTQTSVSIKQLPKIILLARTFSDRLNDRSLQIVFHDQNGHQLSKIQLKLTCLR
ICLDVDADRDGIVEENNPNKGDWKWGVNGHGAILVVNTDRDLVHSCSQYDEKKHIQRLPN
LKELSFIIVRRVGVKTLPDGCKVNLSVDQNIARRICIYDELDQGYCELIGAKRAKAKIRE
TDHDILLGVKGLSYPDVDFDGLVNINLNLTKDGETIYSDRVVFRVAPWIMTPNTLSPITV
FVSRLSKEKNEEFIEELRKVVGKANAQLDPVPFEFHKDDPWMRDEIEIGYTQAPGKCIHV
VLDSPRDRGLDRFAKRKLLGSDFGYVIRKSRYSATKLDSFGNLEVSPPVTVKGIDYPFGR
LIFGGTRQDIIKDPRRKLKVLRDFFFAQKIQAPFEIFSDWLSVGHIDEFMTFVPAPNSKG
FKLLLASPDKCYSILQRLENEGHSQVLLRQGKQLYKKPADISVTDVLDNEELTRENERFQ
EYINWNREALKHELGLGEEDIIDIPALFQDDGDGRAETFFPNMVNMIVLNQHLAIPRPFG
PQINTQCQFEADVRAVLEPLGLVCHFIDDWDPYFRGGGEIHCGTNTSRQPFGQKWWEIEP
KFFNHSSLQG
NT seq 2013 nt NT seq  +upstreamnt  +downstreamnt
atgagagaaatattacagattgaaacatctgctaaagtttattcacgttctcaaaaagaa
agtagagaatatgaagatattttagttgttggtcaaccagcgcaaatctccttagaacat
attgcgccttctgaggatgcaagtattagcttcaaagtgcagggagaaattgaaatttac
tcgaatataaatcaactcgttgatacacaaacctcagtttcgatcaagcagcttccaaag
attatcctgctagcaagaacctttagcgatcgcctcaatgatcgttcgctacaaatagtt
ttccacgatcagaatggtcatcaactgagtaaaattcaactgaagctaacttgtctgcgg
atttgtctagatgtagatgcggatcgcgatggaattgttgaagaaaataatcctaataaa
ggagattggaaatggggagttaatggtcacggtgcgattttagttgttaataccgatcgc
gaccttgttcattcttgcagtcaatatgatgagaaaaaacatattcaaagactaccaaat
ttaaaagaattgagctttatcattgttcgcagagtgggggtgaaaacgcttcctgatggg
tgcaaagttaatttatcggtagatcaaaatattgctaggcgcatttgcatttatgatgaa
ctagatcaaggttattgtgagttaattggagccaagagagcaaaggcaaaaattagagaa
accgaccatgatattctcctaggtgtgaagggattaagttatcctgatgtagattttgat
ggtttggtcaatattaatttaaatcttacaaaagatggagaaacaatctacagcgatcgc
gtagtttttcgcgttgctccttggataatgactcctaatactttatcaccaattactgtg
tttgtatctcgtttatcgaaggaaaaaaacgaagaatttatagaggaactgagaaaagtt
gtaggcaaagccaatgcgcaattagatcctgttccttttgaatttcataaagacgatcct
tggatgcgcgatgaaattgaaataggctatactcaagcaccaggaaaatgcattcacgta
gtacttgattcgccacgcgatcgcggactcgatcgctttgccaaacgcaaattgctagga
agtgattttgggtatgtgattcgtaaaagccgctattcagccacaaaattagattctttt
ggaaatttagaagtttctccaccagtcaccgtcaaaggaattgattatccttttgggcgt
ttgatatttggcggaacgcgccaagacatcatcaaagacccgcgccgcaagttaaaagtt
ttacgagacttcttttttgcacaaaaaattcaagccccgtttgaaatcttctctgattgg
ctgagtgtggggcatatcgatgaatttatgacgtttgttcctgctcctaattctaagggt
tttaagctccttctcgcaagtccagacaagtgttatagcattctccaacgcttagaaaac
gaaggacattctcaggtattattgcgacaaggcaaacagctttataaaaaacctgctgat
attagtgtgacagatgttcttgataacgaagaattgactcgtgaaaacgaacgctttcaa
gaatatattaattggaatcgcgaggctttaaaacacgaattaggtttaggtgaagaagat
attatcgacataccagctttgtttcaagatgatggagatggacgagcggaaacttttttc
cctaacatggttaatatgattgttctcaatcagcatcttgctattcctagaccatttgga
cctcagatcaatactcaatgtcaatttgaagctgatgttcgagcagttttagaacctttg
ggtttagtttgtcactttattgatgattgggacccttattttcgaggaggaggagaaatt
cattgcggtactaatactagccgacaaccttttggtcaaaaatggtgggagattgaacca
aaatttttcaaccattcctcactacagggttaa

DBGET integrated database retrieval system