KEGG   Gloeocapsa sp. PCC 7428: Glo7428_4123Help
Entry
Glo7428_4123      CDS       T02400                                 

Definition
(GenBank) glucokinase
  KO
K00845  glucokinase [EC:2.7.1.2]
Organism
glp  Gloeocapsa sp. PCC 7428
Pathway
glp00010  Glycolysis / Gluconeogenesis
glp00052  Galactose metabolism
glp00500  Starch and sucrose metabolism
glp00520  Amino sugar and nucleotide sugar metabolism
glp00521  Streptomycin biosynthesis
glp01100  Metabolic pathways
glp01110  Biosynthesis of secondary metabolites
glp01120  Microbial metabolism in diverse environments
glp01130  Biosynthesis of antibiotics
glp01200  Carbon metabolism
Brite
KEGG Orthology (KO) [BR:glp00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    Glo7428_4123
   00052 Galactose metabolism
    Glo7428_4123
   00500 Starch and sucrose metabolism
    Glo7428_4123
   00520 Amino sugar and nucleotide sugar metabolism
    Glo7428_4123
  Biosynthesis of other secondary metabolites
   00521 Streptomycin biosynthesis
    Glo7428_4123
   00524 Neomycin, kanamycin and gentamicin biosynthesis
    Glo7428_4123
Enzymes [BR:glp01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.2  glucokinase
     Glo7428_4123
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Glucokinase
Motif
Other DBs
NCBI-ProteinID: AFZ32572
UniProt: K9XLM9
Position
complement(4589474..4590511)
Genome map
AA seq 345 aa AA seqDB search
MTLLLAGDIGGTKTILRLVQQPEIGEIQTLYEERYSSRNYPDLVPIVRQFLATAAEKTGK
DTTPQKACFAIAGPVVNNTVKLTNLAWFLDSQRLEQELKIAPISLINDFAAVSYGVLGLK
EEDLYTLQAGKPQPLAPVAVIGAGTGLGQGFLIKKGEEFDVFASEGGHADFAPRSELEFL
LLKYLLDKHDIQRVSVERVVSGLGIIAIYQFLRDRSYATESPEIAEIVNIWEKQAGSERS
VDPAAAISTAALEGRDRLSEQTLRMFVEAYGAEAGNLALKLLPYNGLYIAGGIAPKILPL
IQEGNFLRAFSSKGRMRSILEDVPVNIVLNPQVGLIGAALYAAKL
NT seq 1038 nt NT seq  +upstreamnt  +downstreamnt
atgacgttgctattagcgggtgatattgggggaactaaaacgattttgcgcttagtgcag
cagccagaaataggcgagatccaaacgctgtatgaagaacgctacagtagccgcaattat
ccagatttagtaccaattgtccggcagtttctcgccaccgcagccgagaaaacaggtaaa
gacacaacgccacaaaaagcgtgttttgcgatcgcaggtccggttgtcaataatacggta
aaactgacaaatctagcgtggtttcttgattcgcaacgtttagaacaagaattaaaaatc
gcgcctatttccctcattaatgattttgccgcagttagctacggcgttttggggttgaag
gaagaagatttatatacgctgcaagcgggtaaaccgcaaccattagccccagttgcagtt
atcggcgcgggaactggattaggacaaggatttttgattaaaaaaggagaagagtttgat
gtattcgcgtcagaaggcggacacgccgattttgcaccgcgttctgagttagaattttta
ctgctaaagtatctgctggataaacacgatattcaaagagtttcagttgaaagggttgtt
tcaggtttagggattattgcaatttatcagtttttgcgcgatcgctcgtatgcaacggaa
tcacctgaaattgctgaaattgtgaatatttgggaaaaacaagcaggaagtgaaagaagc
gtcgatccagcagcagcgatttcaacggctgcattagaagggcgcgatcgcctcagcgaa
caaacgttacgaatgtttgtcgaagcctatggcgcagaagcagggaatcttgctttgaag
cttttaccgtacaatggactttatattgcaggcggaattgcgcctaaaattttaccactc
attcaagaaggtaattttcttcgtgctttttctagtaaaggacgaatgcgctcgatttta
gaagatgtaccagtcaatattgttttaaatccgcaagtaggattaattggtgcggctttg
tatgcggctaaactgtaa

DBGET integrated database retrieval system