KEGG   Gloeocapsa sp. PCC 7428: Glo7428_4148Help
Entry
Glo7428_4148      CDS       T02400                                 

Definition
DNA replication and repair protein RecR
Orthology
K06187  
recombination protein RecR
Organism
glp  Gloeocapsa sp. PCC 7428
Pathway
Homologous recombination
Brite
KEGG Orthology (KO) [BR:glp00001]
 Genetic Information Processing
  Replication and repair
   03440 Homologous recombination
    Glo7428_4148
DNA repair and recombination proteins [BR:glp03400]
 Prokaryotic Type
  DSBR (double strand breaks repair)
   NHEJ (non-homologous end-joining)
    SHDIR (short-homology-dependent illegitimate recombination)
     RecET pathway
      Glo7428_4148
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
4621548..4622096
Genome map
AA seq 182 aa AA seqDB search
MPGVGPKTAQRLALHILKRPETEVQALAQALIDAKQQVGVCSVCFHLSAEPVCEICRNNN
RDNHTICVVSDSRDVIALEKTREYHGKYHVLGGVISPMDGIGPEQLTIQSLVRRVSQQQP
KEVILAISPSVEGETTTLYLGQLLKPFTRVTRIAFGLPVGGDLEYADEVTLARALEGRRE
LD
NT seq 549 nt NT seq  +upstreamnt  +downstreamnt
ttgcctggagttggtcctaaaactgcccagcgcttggctttacatattttaaaaagaccg
gaaacggaagtacaggctttagcacaagctttaattgatgcaaagcaacaagtaggtgtg
tgttctgtctgttttcatttatcggctgaaccagtgtgtgaaatttgtcgaaataataac
cgcgacaatcatactatttgtgtggtgagtgattctcgcgatgtgattgctttggaaaaa
acgagagaatatcatggcaagtaccacgttttgggtggtgtgatttctccgatggatggt
attggtccagaacagttgacaattcaatcgctcgtacgacgagtcagccagcaacaaccc
aaagaggtgattttggcgattagtcctagcgtagaaggagagacgaccaccctatatttg
ggtcagctattaaagccatttacgcgcgttacgcgcattgcttttggtttacctgtaggt
ggcgatttggagtatgcagatgaggtcacacttgctagagcgctcgaaggtagacgagaa
ttagattag

  All links  
No link information was found.   
DBGET integrated database retrieval system