KEGG   Gloeocapsa sp. PCC 7428: Glo7428_4218Help
Entry
Glo7428_4218      CDS       T02400                                 

Definition
protein-L-isoaspartate(D-aspartate)O-methyltrans ferase
Orthology
K00573  
protein-L-isoaspartate(D-aspartate) O-methyltransferase [EC:2.1.1.77]
Organism
glp  Gloeocapsa sp. PCC 7428
Brite
Enzymes [BR:glp01000]
 2. Transferases
  2.1  Transferring one-carbon groups
   2.1.1  Methyltransferases
    2.1.1.77  protein-L-isoaspartate(D-aspartate) O-methyltransferase
     Glo7428_4218
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(4698397..4699551)
Genome map
AA seq 384 aa AA seqDB search
MYIDSLNQMVNKLKEQRAIRSVEIENAFRKVQRHRLLETFYLPGDLQQIAHNPHNPNPEH
LDLIYSGNSLVTRISDGKPSSSTSEPMLIAYMLESLMLTPGLKVLEIGAGTGYNAALIAE
LVGDQTLVVSVDVQEDVIAQTQRLLADAGYPNINLVLRDGFYGVQEEAPYKRIVATVGCK
DISPYWVDQLSPSGFMLLPLTHGGWTPLVKVWLREGTLQGKIVGFSGFMLLQYQESVDDP
WHISAMASLALEEAEELPVFEGIEVEHTRSPLMWSAFPVSFYYFMATKDCRAFWSLTPPG
YGLYDPQRGTILIYPQKNCILLKGDRELYKQLQAIYEDWTQLGKPSPFDYAIEFVPRTQV
TSSPQLGRVIERKFYHQVLSLCEH
NT seq 1155 nt NT seq  +upstreamnt  +downstreamnt
atgtatatagattccttaaatcaaatggtgaacaaactcaaagagcaacgtgcaatacgc
tcagttgagattgagaatgcattccgcaaagttcaacgccatagattactagaaacattt
tatcttccaggtgacttgcaacaaattgcgcataacccacataacccaaatccagaacac
cttgatttaatttactctggcaattcgcttgtgactcgtataagcgatggaaaaccatca
agttcaacgtccgaaccgatgttaattgcgtatatgctagagtcactgatgctcactcca
gggcttaaggttttagaaattggagcgggtacaggctataatgcagctttaattgctgaa
ctggttggcgatcaaactctagtcgtttctgtagatgttcaagaggatgtcattgctcaa
actcaaaggttactcgctgatgcaggctacccaaacattaatttagtgttgcgtgatggc
ttttatggtgttcaagaagaagcaccgtacaagcgaattgttgccacagttggatgtaaa
gatatctcaccttactgggtagatcagctttcaccttcgggctttatgttgttaccacta
actcacggaggctggactccgttagtcaaagtttggctccgagagggtacgcttcaagga
aaaatcgttggtttttctggttttatgctcttgcaatatcaagagtctgtagatgaccct
tggcatatttctgctatggcttcacttgcgctagaagaggctgaggaacttcccgttttt
gaggggattgaagttgagcatacccgtagccctctcatgtggtctgcttttccagttagc
ttctactattttatggcaacgaaagactgtcgtgctttttggagtctcactcctccaggt
tatggtctttatgacccacaacgtggcacaattctcatctacccgcaaaagaattgcata
cttctcaaaggcgatcgcgaactctataaacaactgcaagccatatatgaagattggaca
cagttgggtaaacccagtcccttcgactatgcaattgagtttgtcccacgtacgcaagta
acgtcatcacctcaattaggtagggtaattgagcgcaagttttatcatcaagttctgtct
ttatgcgaacattaa

DBGET integrated database retrieval system