KEGG   Gloeocapsa sp. PCC 7428: Glo7428_4577Help
Entry
Glo7428_4577      CDS       T02400                                 

Definition
Glutathione S-transferase domain protein
Orthology
K00799  
glutathione S-transferase [EC:2.5.1.18]
Organism
glp  Gloeocapsa sp. PCC 7428
Pathway
Glutathione metabolism
Brite
KEGG Orthology (KO) [BR:glp00001]
 Metabolism
  Metabolism of other amino acids
   00480 Glutathione metabolism
    Glo7428_4577
Enzymes [BR:glp01000]
 2. Transferases
  2.5  Transferring alkyl or aryl groups, other than methyl groups
   2.5.1  Transferring alkyl or aryl groups, other than methyl groups (only sub-subclass identified to date)
    2.5.1.18  glutathione transferase
     Glo7428_4577
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
5090628..5091419
Genome map
AA seq 263 aa AA seqDB search
MLELYQFELSQYSEKVRLILDFKGLAYRKIEVTPGVGQLELFRLTGQRQVPVLKDGNQYI
ADSTQIAKYLERKYPDRPIIPSDPKQRAMCWLIEEWADESIGIKSRKALFGALTQSESYR
KSLLPMATPDVVKTLIGVVPNDVLKVLGFGVGYGPDVIKSAEEDLKQDLEALCLLLAENP
YLVGDQPTLADLAVAGLAMLLKFPDGPYLELPATLKGKGIPGLGDNIAYQPFFEWRDRLY
AQYRKPLTGVSTVGSTPTSIQID
NT seq 792 nt NT seq  +upstreamnt  +downstreamnt
atgttagaactctaccaatttgaactatcacaatattcagaaaaagttcgcttaatatta
gattttaaaggattagcttatcgcaaaatcgaggtcactcctggagtaggacagctagag
ctttttcggttgacgggtcaaagacaagttcccgtactcaaggatggtaatcaatatatt
gctgattctacacaaatcgctaaatatctcgaacgcaagtatcctgaccgcccaattatt
ccatccgatccaaaacaacgcgcaatgtgttggctgattgaagaatgggcagacgaatca
atcggtatcaaaagccgtaaagcattattcggagcactcactcaaagtgaaagttaccgt
aagtcactgttaccaatggcaactcctgatgtagtaaaaacactgataggagttgtccct
aatgatgttctaaaagtactaggttttggtgtaggatatggaccagacgttattaaatcg
gctgaagaagatttaaaacaagatttggaagcactttgcttgttacttgcagagaatccc
tacttagttggggatcaaccaacgctcgctgatttagctgttgcaggtttggcaatgtta
ctcaagtttcctgacggaccttatctagaattaccagcgacactaaaagggaaaggaatt
cctggtttaggcgacaatatcgcgtatcaaccattttttgagtggcgcgatcgcctgtat
gcacagtatcgtaaaccactaacaggagtcagtacagtcggttccacaccaacatcaatc
caaatcgactaa

DBGET integrated database retrieval system