KEGG   Gloeocapsa sp. PCC 7428: Glo7428_4677Help
Entry
Glo7428_4677      CDS       T02400                                 

Definition
UTP--glucose-1-phosphate uridylyltransferase (EC:2.7.7.9)
Orthology
K00963  
UTP--glucose-1-phosphate uridylyltransferase [EC:2.7.7.9]
Organism
glp  Gloeocapsa sp. PCC 7428
Pathway
Pentose and glucuronate interconversions
Galactose metabolism
Starch and sucrose metabolism
Amino sugar and nucleotide sugar metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Module
Nucleotide sugar biosynthesis, prokaryotes
Brite
KEGG Orthology (KO) [BR:glp00001]
 Metabolism
  Carbohydrate metabolism
   00040 Pentose and glucuronate interconversions
    Glo7428_4677
   00052 Galactose metabolism
    Glo7428_4677
   00500 Starch and sucrose metabolism
    Glo7428_4677
   00520 Amino sugar and nucleotide sugar metabolism
    Glo7428_4677
Enzymes [BR:glp01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.7  Nucleotidyltransferases
    2.7.7.9  UTP---glucose-1-phosphate uridylyltransferase
     Glo7428_4677
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(5213860..5214741)
Genome map
AA seq 293 aa AA seqDB search
MKIRKAVIPAAGFGTRLFPATKAIKKELFPIIDKDGRAKPVIQIIVEEAISAGIEEIGII
VQTSDRLLFEDFFKSPPKPELLQKLSPQNQEYSQYLQDLGSKVTILTQDTQEGYGHAVFC
ARDWVNNEPFLLMLGDHIYASDTENSCTAQVLEIYNLVNQNTIGLTTMPAEIIYKAGCVT
GTWQQNSLLNLTQVYEKPSIEYARQYLRVERIPEDEFLCIFGLYALSPKLFDFLEEHIKN
NIRDRGEFQLTSALESLRQVEGMTGYIVKGRCFDTGMPDAYLQTMIDFRGKHS
NT seq 882 nt NT seq  +upstreamnt  +downstreamnt
atgaaaattcgtaaagcggtaattcccgcagcagggttcggtactcgtttattcccagca
accaaagctattaaaaaagaactctttccgattatcgacaaagatggaagagcaaaacct
gttattcaaataattgtggaagaagcaattagcgcgggaattgaagaaattggtatcatc
gtacaaacaagcgatcgcctactctttgaagacttttttaaatcaccacccaaaccagaa
cttctccaaaaattatcaccacaaaatcaagaatatagccaatatctccaagatttaggt
agcaaagttacaatcttgacacaagatacacaagaaggctacggtcatgcggtattctgt
gccagagattgggtaaataacgaaccttttctattaatgctaggcgatcatatttacgct
tctgatactgaaaactcatgtactgcacaagttttagaaatttataacctagttaatcaa
aatacaattggattaacaacaatgccagcagaaataatttataaagctggttgcgttaca
ggtacttggcaacaaaattcactgcttaatctgacgcaagtctacgagaaaccatcgatt
gaatatgcgcgtcaatatttacgtgtagagcgaatacctgaagatgaatttttgtgtata
tttggcttatacgcactatcgccaaaactatttgattttctagaagaacatattaagaat
aatatccgcgatcgcggcgaatttcaattaacatctgcgctagaaagcttacgtcaagtg
gaaggaatgacgggctacattgttaagggacgttgttttgatacaggaatgcccgatgct
tatctccaaacaatgattgattttagaggaaagcattcttaa

DBGET integrated database retrieval system