KEGG   Gloeocapsa sp. PCC 7428: Glo7428_4988Help
Entry
Glo7428_4988      CDS       T02400                                 

Definition
(GenBank) Glutathione S-transferase domain protein
  KO
K00799  glutathione S-transferase [EC:2.5.1.18]
Organism
glp  Gloeocapsa sp. PCC 7428
Pathway
glp00480  Glutathione metabolism
Brite
KEGG Orthology (KO) [BR:glp00001]
 Metabolism
  Metabolism of other amino acids
   00480 Glutathione metabolism
    Glo7428_4988
Enzymes [BR:glp01000]
 2. Transferases
  2.5  Transferring alkyl or aryl groups, other than methyl groups
   2.5.1  Transferring alkyl or aryl groups, other than methyl groups (only sub-subclass identified to date)
    2.5.1.18  glutathione transferase
     Glo7428_4988
Transporters [BR:glp02000]
 Other Transporters
  Pores ion channels [TC:1]
   Glo7428_4988
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: GST_N GST_N_3 GST_N_2 GST_C_3 GST_C GST_C_2 COR
Motif
Other DBs
NCBI-ProteinID: AFZ33391
UniProt: K9XMV7
Position
pGLO7428.01:131624..132292
Genome map
AA seq 222 aa AA seqDB search
MIVVHHLNNSRSQRILWLLEELELNYEIKRYERKPKTMLAPESLREVHPLGKSPVITDEA
LTLAESGAIIEYLVERYGKGRFVPPPGTAERLRYTYWLHYAEGSAMPLLLLKLVFDRIEQ
QAPFFVKPMAQLIANQTKSSFIEPRIKQHLNYLEAELGKSLWFAGEEFTAADVQMSFPIE
VAVSRAGLDASYPKLIDFLERIHARPAYQRALERGGTYELLS
NT seq 669 nt NT seq  +upstreamnt  +downstreamnt
atgattgtcgttcaccacttaaataactcccgctcccagcgcatactctggttgctagaa
gaactcgaactaaattatgaaatcaagcgctacgagcgcaaaccaaaaacaatgcttgca
ccagaatcgctgcgtgaggtacatccattaggtaagtctccagtaattaccgatgaagca
ctaactttggcagaatctggggctattattgagtatctagttgagcgttatggtaaggga
cgatttgtgccaccaccaggcacagcagaacggttacggtatacctactggttacactat
gctgaaggctctgcaatgccgctactcttattaaaattagtgtttgaccggattgagcag
caagcgcctttttttgtcaaaccgatggcgcagttgattgcaaatcaaacaaaaagttct
ttcatagaaccccgaattaaacaacatcttaattatttagaagcagaacttggaaaaagc
ctgtggtttgcaggtgaggaatttaccgcagccgatgttcaaatgagctttcctatcgag
gtagcggttagtcgagcaggcttagacgcaagttatcctaagttaatcgactttctggaa
cgcattcacgcacgtccagcataccaacgcgctttagaacgaggcggcacttatgagcta
ctgagttga

DBGET integrated database retrieval system