KEGG   Gloeocapsa sp. PCC 7428: Glo7428_4988Help
Entry
Glo7428_4988      CDS       T02400                                 

Definition
Glutathione S-transferase domain protein
Orthology
K00799  
glutathione S-transferase [EC:2.5.1.18]
Organism
glp  Gloeocapsa sp. PCC 7428
Pathway
Glutathione metabolism
Class
Metabolism; Metabolism of other amino acids; Glutathione metabolism [PATH:glp00480]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
pGLO7428.01:131624..132292
Genome map
AA seq 222 aa AA seqDB search
MIVVHHLNNSRSQRILWLLEELELNYEIKRYERKPKTMLAPESLREVHPLGKSPVITDEA
LTLAESGAIIEYLVERYGKGRFVPPPGTAERLRYTYWLHYAEGSAMPLLLLKLVFDRIEQ
QAPFFVKPMAQLIANQTKSSFIEPRIKQHLNYLEAELGKSLWFAGEEFTAADVQMSFPIE
VAVSRAGLDASYPKLIDFLERIHARPAYQRALERGGTYELLS
NT seq 669 nt NT seq  +upstreamnt  +downstreamnt
atgattgtcgttcaccacttaaataactcccgctcccagcgcatactctggttgctagaa
gaactcgaactaaattatgaaatcaagcgctacgagcgcaaaccaaaaacaatgcttgca
ccagaatcgctgcgtgaggtacatccattaggtaagtctccagtaattaccgatgaagca
ctaactttggcagaatctggggctattattgagtatctagttgagcgttatggtaaggga
cgatttgtgccaccaccaggcacagcagaacggttacggtatacctactggttacactat
gctgaaggctctgcaatgccgctactcttattaaaattagtgtttgaccggattgagcag
caagcgcctttttttgtcaaaccgatggcgcagttgattgcaaatcaaacaaaaagttct
ttcatagaaccccgaattaaacaacatcttaattatttagaagcagaacttggaaaaagc
ctgtggtttgcaggtgaggaatttaccgcagccgatgttcaaatgagctttcctatcgag
gtagcggttagtcgagcaggcttagacgcaagttatcctaagttaatcgactttctggaa
cgcattcacgcacgtccagcataccaacgcgctttagaacgaggcggcacttatgagcta
ctgagttga

DBGET integrated database retrieval system