KEGG   Granulicella mallensis: AciX8_0211Help
Entry
AciX8_0211        CDS       T01664                                 

Definition
dihydropteroate synthase
Orthology
K00796  
dihydropteroate synthase [EC:2.5.1.15]
Organism
gma  Granulicella mallensis
Pathway
Folate biosynthesis
Metabolic pathways
Class
Metabolism; Metabolism of cofactors and vitamins; Folate biosynthesis [PATH:gma00790]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
complement(245791..246738)
Genome map
AA seq 315 aa AA seqDB search
MAAVYIYNSQMTFAPRPHFDWRLRTRTLALGERTLIMAIVNLTPDSFSGDGVARQDTGQM
TAAGIAAAVAAVDSGADIIDLGAESTRPSSEPLSSEEEQLRLLPVLEGLLRERSQAIVSV
DTYHAATARNAALMGAEIINDVSGLLWDKAMVTTVASAHCGLLLMHTRGRPQDWRALPPL
TPEEVVPLVQEGLREQLMVAQSAGISREHIVIDPGFGFGKLGRDNFALLAGLHQLSKLGY
PLLAGVSRKAFLGEAVRAVQPAGLPLAEARRTATIAANVAAILNGAHILRVHDVQQAREA
AAVADAVKQGLGHRG
NT seq 948 nt NT seq  +upstreamnt  +downstreamnt
atggccgcagtctacatctacaattcgcagatgaccttcgccccgcgtccacactttgac
tggcggctccgcacccgaacgctcgcactgggcgagcgaacgctgatcatggcgatcgtc
aacctgacgcccgacagcttctccggcgacggcgtcgcccggcaggacacaggccagatg
actgccgccggaatcgccgcagccgtcgcggcggtcgacagcggcgccgacatcatcgat
cttggcgcggagtcgacgcggcccagctccgagccactcagctccgaagaggaacaactg
cgcctgctgcccgttctcgagggcctattacgggagcgctcccaggcgatcgtctccgtc
gatacgtaccacgcggccacggcacggaacgcagcccttatgggagctgagatcatcaat
gatgtctccggcctgttatgggataaagccatggttacgaccgtcgcctccgcacactgc
ggcctgctgctgatgcatacccgcggccgtccgcaggactggcgcgccctgccccctttg
actccggaagaggtcgttcccctggtgcaggagggactgcgggagcagctcatggtggcc
cagtccgccggcatctcccgggaacatatcgtcatcgatccgggattcggcttcggcaag
ctgggccgggacaacttcgcgctgttggcgggtcttcaccaactcagcaagcttggttac
cctctcctggccggggtttctcgcaaggcctttctcggtgaggcggtgcgtgccgtccaa
ccggcaggcctgcccctcgccgaggcacgccgtactgcaaccatcgccgcaaacgtcgcc
gccatcttgaatggagcgcacattctgcgtgtgcacgatgtgcagcaggcaagagaagct
gcggcagtagcagatgcggtaaagcagggattagggcacaggggttag

DBGET integrated database retrieval system