KEGG   Granulicella mallensis: AciX8_0395Help
Entry
AciX8_0395        CDS       T01664                                 

Definition
phenylalanyl-tRNA synthetase subunit alpha
Orthology
K01889  
phenylalanyl-tRNA synthetase alpha chain [EC:6.1.1.20]
Organism
gma  Granulicella mallensis
Pathway
Aminoacyl-tRNA biosynthesis
Module
Aminoacyl-tRNA biosynthesis, prokaryotes
Class
Genetic Information Processing; Translation; Aminoacyl-tRNA biosynthesis [PATH:gma00970]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
466561..467661
Genome map
AA seq 366 aa AA seqDB search
MNIPQLTDFTEASLDAAFAAVRSEADATVAAPGFDAEQFRLEWLGRKQGHLKAISDAWLK
AAPPEAKKLIGQRFNALKEQIEGSLASAGTAETKPAAAGLDVTLPGSAQRLGVEHPLVRT
MAEIVGVFQRMGYSVGLGPEVESDFYNFESLNFPPNHPARDTQDTLVVAEQEGKPLRERL
LMRTHTSPVQIRSMLEQAPPLRLVIPGKVHRNDAADATHSPVFHQVEGLCVDTNITFSDL
KGTLDHAMKAFFGSAVKTRFFPSFFPFTEPSADVQISCIFCGGKGCRKCKHSGWIELLGC
GMVDPAVFEAVNKRRIELGRDPVYDTRRISGFAFGMGVDRIAMMKYGISDIGLLYSGDMR
FLEQFA
NT seq 1101 nt NT seq  +upstreamnt  +downstreamnt
ttgaatattccgcaacttacagatttcactgaggcatctctggatgccgccttcgccgct
gttcgcagcgaagctgacgccacggtagccgctcccggcttcgacgccgagcagttccgt
ctggaatggctgggccgcaagcagggtcacctgaaggcgatctccgatgcgtggctcaaa
gccgcgccacccgaggcgaagaaactcatcggccagcgcttcaacgcgctcaaggagcag
atcgaaggctccctggcttcggccggcacggcggagaccaagcctgcagcagcggggctg
gacgtcactctgcccggcagcgcacagcgcctcggggttgagcatccgctggtcaggaca
atggccgagatcgtcggagtcttccagcgcatgggctactccgtgggcctggggccggag
gtcgagagcgacttctacaacttcgagagcctgaactttccgccgaaccatccggcccgc
gatacgcaggacaccctggtcgtcgccgagcaggagggcaagccgctacgcgagcgtctg
ctgatgcgcacgcacacctccccggtacagattcgctccatgctggagcaggctccgccg
ctacggctggtgattccgggcaaggtgcatcgcaacgatgccgccgacgccacacactcg
ccggtcttccaccaggtcgagggtctgtgtgtggatacgaacatcaccttcagcgacctg
aagggcacgctcgaccacgcgatgaaggcctttttcggctccgcggtcaagacgcgcttc
ttcccgtcgttctttccgttcaccgagcccagcgcggacgtgcagatctcgtgcatcttc
tgcggtggcaagggctgccgcaagtgcaagcactcgggctggatcgagctgctgggctgc
ggcatggtggaccctgcggtattcgaggcagtaaataagcgccgcatcgaactgggccgc
gacccggtctatgacacgcgccgcatcagcggcttcgcctttggcatgggcgtcgaccgc
atcgccatgatgaagtacggcatctcagacatcggtctcctgtactccggagacatgcgc
tttttggagcagttcgcttga

DBGET integrated database retrieval system