KEGG   Granulicella mallensis: AciX8_0395Help
Entry
AciX8_0395        CDS       T01664                                 

Definition
phenylalanyl-tRNA synthetase subunit alpha
Orthology
K01889  
phenylalanyl-tRNA synthetase alpha chain [EC:6.1.1.20]
Organism
gma  Granulicella mallensis
Pathway
Aminoacyl-tRNA biosynthesis
Module
Aminoacyl-tRNA biosynthesis, prokaryotes
Brite
KEGG Orthology (KO) [BR:gma00001]
 Genetic Information Processing
  Translation
   00970 Aminoacyl-tRNA biosynthesis
    AciX8_0395
Enzymes [BR:gma01000]
 6. Ligases
  6.1  Forming carbon-oxygen bonds
   6.1.1  Ligases forming aminoacyl-tRNA and related compounds
    6.1.1.20  phenylalanine---tRNA ligase
     AciX8_0395
Amino acid related enzymes [BR:gma01007]
 Aminoacyl-tRNA synthetase
  Class II (U)
   AciX8_0395
Transfer RNA biogenesis [BR:gma03016]
 Eukaryotic Type
  Aminoacyl-tRNA synthetases (AARSs)
   Other AARSs
    AciX8_0395
 Prokaryotic Type
    AciX8_0395
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
466561..467661
Genome map
AA seq 366 aa AA seqDB search
MNIPQLTDFTEASLDAAFAAVRSEADATVAAPGFDAEQFRLEWLGRKQGHLKAISDAWLK
AAPPEAKKLIGQRFNALKEQIEGSLASAGTAETKPAAAGLDVTLPGSAQRLGVEHPLVRT
MAEIVGVFQRMGYSVGLGPEVESDFYNFESLNFPPNHPARDTQDTLVVAEQEGKPLRERL
LMRTHTSPVQIRSMLEQAPPLRLVIPGKVHRNDAADATHSPVFHQVEGLCVDTNITFSDL
KGTLDHAMKAFFGSAVKTRFFPSFFPFTEPSADVQISCIFCGGKGCRKCKHSGWIELLGC
GMVDPAVFEAVNKRRIELGRDPVYDTRRISGFAFGMGVDRIAMMKYGISDIGLLYSGDMR
FLEQFA
NT seq 1101 nt NT seq  +upstreamnt  +downstreamnt
ttgaatattccgcaacttacagatttcactgaggcatctctggatgccgccttcgccgct
gttcgcagcgaagctgacgccacggtagccgctcccggcttcgacgccgagcagttccgt
ctggaatggctgggccgcaagcagggtcacctgaaggcgatctccgatgcgtggctcaaa
gccgcgccacccgaggcgaagaaactcatcggccagcgcttcaacgcgctcaaggagcag
atcgaaggctccctggcttcggccggcacggcggagaccaagcctgcagcagcggggctg
gacgtcactctgcccggcagcgcacagcgcctcggggttgagcatccgctggtcaggaca
atggccgagatcgtcggagtcttccagcgcatgggctactccgtgggcctggggccggag
gtcgagagcgacttctacaacttcgagagcctgaactttccgccgaaccatccggcccgc
gatacgcaggacaccctggtcgtcgccgagcaggagggcaagccgctacgcgagcgtctg
ctgatgcgcacgcacacctccccggtacagattcgctccatgctggagcaggctccgccg
ctacggctggtgattccgggcaaggtgcatcgcaacgatgccgccgacgccacacactcg
ccggtcttccaccaggtcgagggtctgtgtgtggatacgaacatcaccttcagcgacctg
aagggcacgctcgaccacgcgatgaaggcctttttcggctccgcggtcaagacgcgcttc
ttcccgtcgttctttccgttcaccgagcccagcgcggacgtgcagatctcgtgcatcttc
tgcggtggcaagggctgccgcaagtgcaagcactcgggctggatcgagctgctgggctgc
ggcatggtggaccctgcggtattcgaggcagtaaataagcgccgcatcgaactgggccgc
gacccggtctatgacacgcgccgcatcagcggcttcgcctttggcatgggcgtcgaccgc
atcgccatgatgaagtacggcatctcagacatcggtctcctgtactccggagacatgcgc
tttttggagcagttcgcttga

DBGET integrated database retrieval system