KEGG   Granulicella mallensis: AciX8_0437Help
Entry
AciX8_0437        CDS       T01664                                 

Definition
(GenBank) UTP-glucose-1-phosphate uridylyltransferase
  KO
K00963  UTP--glucose-1-phosphate uridylyltransferase [EC:2.7.7.9]
Organism
gma  Granulicella mallensis
Pathway
gma00040  Pentose and glucuronate interconversions
gma00052  Galactose metabolism
gma00500  Starch and sucrose metabolism
gma00520  Amino sugar and nucleotide sugar metabolism
gma01100  Metabolic pathways
gma01130  Biosynthesis of antibiotics
Module
gma_M00362  Nucleotide sugar biosynthesis, prokaryotes
gma_M00549  Nucleotide sugar biosynthesis, glucose => UDP-glucose
Brite
KEGG Orthology (KO) [BR:gma00001]
 Metabolism
  Carbohydrate metabolism
   00040 Pentose and glucuronate interconversions
    AciX8_0437
   00052 Galactose metabolism
    AciX8_0437
   00500 Starch and sucrose metabolism
    AciX8_0437
   00520 Amino sugar and nucleotide sugar metabolism
    AciX8_0437
Enzymes [BR:gma01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.7  Nucleotidyltransferases
    2.7.7.9  UTP---glucose-1-phosphate uridylyltransferase
     AciX8_0437
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: NTP_transferase NTP_transf_3 IspD CTP_transf_3
Motif
Other DBs
NCBI-ProteinID: AEU34790
JGI: AciX8_0437
UniProt: G8NNK5
Position
complement(510347..511225)
Genome map
AA seq 292 aa AA seqDB search
MAFLKVRKAVIPAAGMGTRFLPATKATPKEMLPLVDKPLIQYAVEEAVAAGCTEIIIVTG
RNKATMEDHFDKSPELEASLIARNRPALLEIAQSVTRLARIVYTRQAEPLGLGHAVLQAK
DLIGDEPFAVILPDDVVDCTVPCMKQMVEAFDRTQSSILASEVVEREAISHYGCLDCTPD
PEDKRLLDVRDMVEKPKPEEAPSLNAIIGRYILTPRIFEMIENIKPGAGGELQLTDAIKA
LLQYEKVYGFCYTGKRHDAGDKFGFLKATVDFALKHNELGPKFREWLKSQQF
NT seq 879 nt NT seq  +upstreamnt  +downstreamnt
atggctttcttgaaggtccgcaaggccgtgattcctgcggcaggcatgggtacccggttt
cttcccgccaccaaggcaactcccaaggagatgctgcccctggtggacaagcctctgatt
cagtatgcggtcgaagaggctgtggccgccggatgcacggagatcatcatcgtcaccggc
cgcaataaggcgacgatggaggatcacttcgacaagtcaccggagctggaggcgtcgctg
atcgcgcgcaaccggccggcattgctggagatcgctcaatcggtcacccggctggcgcgt
atcgtctacacccgtcaggccgagccgctggggcttggccatgccgtgctgcaggccaag
gatctgatcggcgatgagcccttcgccgtgattcttccggacgatgtcgtggactgcacc
gttccctgcatgaagcagatggtggaggctttcgataggacgcaatcctccatcctggct
tcggaggttgtggagcgcgaggcgatctcgcactatggctgcctggactgcacgcccgac
ccggaggacaaacggctgctcgacgttcgggacatggtcgaaaagccgaagcctgaagag
gctcccagcctgaacgccatcatcggccgttacattctgacgccgcgcatcttcgagatg
atcgaaaatatcaagcccggtgcgggcggcgagttacagcttaccgatgccatcaaggcg
ctgctgcagtatgagaaggtctatggtttttgctacacaggcaaacgtcatgatgcaggc
gataagttcggcttcctgaaagcgaccgttgatttcgcgctgaagcacaatgagctggga
ccgaagttccgcgagtggttgaagtcgcagcagttttaa

DBGET integrated database retrieval system