KEGG   Granulicella mallensis: AciX8_0621Help
Entry
AciX8_0621        CDS       T01664                                 

Definition
(RefSeq) succinyl-CoA synthetase, beta subunit
  KO
K01903  
succinyl-CoA synthetase beta subunit [EC:6.2.1.5]
Organism
gma  Granulicella mallensis
Pathway
Citrate cycle (TCA cycle)
Propanoate metabolism
C5-Branched dibasic acid metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Biosynthesis of antibiotics
Carbon metabolism
Module
Citrate cycle (TCA cycle, Krebs cycle)
Citrate cycle, second carbon oxidation, 2-oxoglutarate => oxaloacetate
Brite
KEGG Orthology (KO) [BR:gma00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    AciX8_0621
  Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    AciX8_0621
   00640 Propanoate metabolism
    AciX8_0621
   00660 C5-Branched dibasic acid metabolism
    AciX8_0621
Enzymes [BR:gma01000]
 6. Ligases
  6.2  Forming carbon-sulfur bonds
   6.2.1  Acid-thiol ligases
    6.2.1.5  succinate---CoA ligase (ADP-forming)
     AciX8_0621
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
716514..717692
Genome map
AA seq 392 aa AA seqDB search
MKIHEYQAKEILRKYGVAVPNGEMATTIEEADAAAKQLFSAGNAVVVVKAQIHAGGRGKG
GGVKLARSLEEAAVYSKSILGMQLVTHQTGPAGQKVQRLLVEAGSAIARELYLGLVLDRA
SSKVVFMASQAGGMEIEEVAHENPDAIFKEYVNPAIGLQPYQARALAFKLGLEPAQIGEA
VRFMLGLYKAFIETDSTLMEINPFITTKDGKLLALDCKINFDDNAMFRHKDLKELRDLSE
EDPLEVEASKYALNYIKLDGNIACMVNGAGLAMATMDIIQYAGGSAANFLDVGGGANQEQ
IENAFGILLSDPNVKAIFINIFGGILRVDVLATAVVAAAKKLNVQLPIILRLEGTNVEEG
RKILAESGLKFEVGATMKEAADLAVAAAKGVN
NT seq 1179 nt NT seq  +upstreamnt  +downstreamnt
atgaagatccacgagtaccaggccaaagagatcctccggaagtacggcgtcgccgtaccc
aatggagagatggccaccacgatcgaagaggccgatgcggccgccaagcagcttttctcc
gccggtaacgcggttgtcgtcgtcaaggcgcagatccacgcgggtgggcgcggcaagggc
ggcggcgtcaagctggcgcgttcgctggaagaggctgccgtgtactcgaagagcatcctc
ggcatgcagcttgtgacgcaccagaccggccccgccggacagaaggtgcagcggttgctg
gtcgaggccggttcggccatcgctcgcgagctgtatctcggactggtgctcgaccgcgct
tcatcgaaggtcgtgttcatggcctctcaggcgggcggcatggagatcgaagaggtagcg
cacgagaatcccgacgccatcttcaaggagtacgtcaatccagccatcggcctgcagccc
taccaggcccgcgctctggcgttcaagcttgggctggagcctgcgcagatcggcgaggcg
gtaaggttcatgctcggcctttacaaggccttcattgagaccgattcgacgctgatggag
atcaatcctttcatcacgaccaaggacggcaagctcctcgcgctcgactgcaagatcaac
ttcgacgacaacgcgatgttccgtcacaaggacctgaaggagctgcgcgacctgagcgag
gaagacccgctcgaagtcgaggccagcaagtacgcgctcaactacatcaagctcgacggc
aacatcgcgtgcatggtgaacggcgcaggcctcgcgatggcgacgatggacatcatccag
tacgccggcggctcggctgcgaacttcctcgatgtcggcggcggcgcgaaccaggagcag
attgaaaatgccttcggcatcctgttgagcgatccgaatgtgaaggccatcttcatcaac
atcttcggtggcatcctgcgtgtcgacgtgctggcgacagcagtcgttgcggctgcgaag
aagttgaacgtgcagcttccgatcatcctgcgtcttgaaggaacgaacgtcgaagaaggc
cgcaagattctcgctgaatctggcctcaagtttgaagtgggagccaccatgaaagaagcc
gccgaccttgcggttgccgcagcgaagggagtcaactaa

DBGET integrated database retrieval system