KEGG   Granulicella mallensis: AciX8_0775Help
Entry
AciX8_0775        CDS       T01664                                 

Definition
ribokinase
Orthology
K00852  
ribokinase [EC:2.7.1.15]
Organism
gma  Granulicella mallensis
Pathway
Pentose phosphate pathway
Brite
KEGG Orthology (KO) [BR:gma00001]
 Metabolism
  Carbohydrate metabolism
   00030 Pentose phosphate pathway
    AciX8_0775
Enzymes [BR:gma01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.15  ribokinase
     AciX8_0775
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
887463..888404
Genome map
AA seq 313 aa AA seqDB search
MSHNVLVLGSFVADVAFRMSRLPAWGETLMGETFALGPGGKGSNQAVAAARALAGSDAKV
LFLSRVGEDAFGTLARDTWKEAGVDASLVSTCSTATGAAAILIDAVKGENAIIVVPGACF
TLEPADVESAAAEIGAASVFLTQLELPLDTVERGLQIARKAGVPTILNPAPAPATPLPAS
LIGLADYLIPNETEAALLTGLPVETVEQAGLAAAALLAAGARNVILTLGARGALVATGDG
QTTLVASFNAGPVLETTGAGDAFCGGFATALAEGQPLLDAVRFGCATAGISVTRAGTAPS
MPHRHEIEGLLAR
NT seq 942 nt NT seq  +upstreamnt  +downstreamnt
atgagtcataacgttcttgtgcttggaagctttgttgccgatgtggcgtttcgcatgtcc
cgtctgccggcgtggggtgagacgctgatgggagagaccttcgccctcgggcccggcggc
aagggctcgaaccaggccgtcgcggctgcgcgtgctcttgccggttcggatgcaaaggtg
ctgtttttgtcccgggtaggagaggatgcgtttggcacgctggctcgcgatacctggaag
gaggccggtgtggacgcctcgctggtcagcacctgcagcacggcgaccggagccgcagcg
attctcatcgacgctgtgaagggtgagaacgcgatcatcgttgtgccgggcgcctgcttc
acgcttgagcctgccgatgtcgagagcgctgcagcggagatcggcgcagccagtgtcttc
ctcacccagcttgagcttccgctcgacacggtcgagcgcggtctacagatcgcccgcaag
gccggtgtgcccacgatcctgaatcccgcacccgcgccggcgactccgctgccggcatcg
ctgataggtctggccgattacctgatccccaatgagactgaagccgcgttgctgacgggc
ctgcctgtcgagacggtcgaacaggccgggctggctgccgcggcactcctcgctgccgga
gcgcgaaacgtgattcttacgcttggtgcgcgaggagcgctggtggctacaggcgacggc
cagacgacgctggttgcttctttcaatgcaggccctgttctcgaaacgacgggcgctggc
gatgccttctgcggcggctttgcgacggcacttgccgaagggcagccgctgctcgatgcg
gtacgttttggttgtgcgacggcgggtatctcggtcacgcgagcaggcaccgcaccctcg
atgccgcatcggcatgagattgagggcctgctcgcccgttga

DBGET integrated database retrieval system