KEGG   Granulicella mallensis: AciX8_0890Help
Entry
AciX8_0890        CDS       T01664                                 

Definition
Alpha-galactosidase
Orthology
K07407  
alpha-galactosidase [EC:3.2.1.22]
Organism
gma  Granulicella mallensis
Pathway
Galactose metabolism
Glycerolipid metabolism
Sphingolipid metabolism
Brite
KEGG Orthology (KO) [BR:gma00001]
 Metabolism
  Carbohydrate metabolism
   00052 Galactose metabolism
    AciX8_0890
  Lipid metabolism
   00561 Glycerolipid metabolism
    AciX8_0890
   00600 Sphingolipid metabolism
    AciX8_0890
Enzymes [BR:gma01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.22  alpha-galactosidase
     AciX8_0890
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
1049703..1051937
Genome map
AA seq 744 aa AA seqDB search
MMRNFAWLCRAVVLLGISVVATSQAQTKAAPALIGFDPSTKVFRINAADTTLVMGINESG
QVQTLYWGEHLSAKDHFAVAKAMPGASSFDLPVTTTPQEFVAWGGGLFVEPDLKITFPDG
NRDLVLKYVSHTIDANRLSIVMKDISREVYVTLQYEADAETGILRRSAVVENRTEAPFTI
EQIAAGTWNLPRGTDYRLRYLTGRWAGEWSLQEQPVNPGKVVLESRRGTTGAQNNPWFAI
DRSGSADQDEGGVWFGALGWSGSWQISVEQDALQQVRITGGPNAFDFGYLLKKGERFQTP
CFYGGYSAHGIGGASRLLHRFEVNSLLPHHPDSKLRPVLYNSWEATGFDVDEAGQMSLAE
KAAKIGVERFVMDDGWFGQRKNDHAGLGDWYVNPQKFPHGLKPLIDKVHSLKMDFGLWVE
PEMVNPDSDLYRKHPDWVLEFPGRPHTEARHQLVLNLARPDVRAYVYGFLDKLLKENDIS
FLKWDYNRNWSEPGWPAVPQEQEKNVYIDFIRNYYSILDELRHEHPKVEIESCSGGGSRV
DLGVMQYTDEVWPSDNTDAYDRLLIQNGFTYAYTPATMMAWVTDSPNWVNNRALSLEYRF
LSSMQGSLGIGANLNQWKPEDFATARQMVERYKSIRETVQRGALYRLLTPEHNSEQSITE
TVSRDGDQAVVFAFLHSSQENYPFPRIFLRGLDEGATYSISAFAGKLAEGTPTQASGSYW
EHHGIDVDLHGDFQAMAFTLKRSR
NT seq 2235 nt NT seq  +upstreamnt  +downstreamnt
atgatgagaaattttgcatggttatgccgtgcagttgttttgttgggtatctccgttgtt
gcaacgtcccaggctcaaacgaaggcagcgccggcgcttatcgggtttgatccttccacg
aaggtctttcgtatcaatgcggccgacacgactcttgtgatggggatcaacgagagcggc
caggtgcaaaccctgtattggggtgagcacctctcggcaaaggaccactttgctgtagca
aaagcaatgccaggtgcttcatcctttgatctgccagtgacgaccacgccgcaagagttt
gtggcgtggggtggaggcttatttgtcgaacctgatctgaagatcacatttccggatggc
aatcgggatcttgtgctgaagtacgtttcgcatacgatcgatgccaacaggctttcaatc
gtgatgaaagacatctcgcgtgaggtgtatgtcacgcttcagtatgaagccgatgcggag
accggcatcctgcggcgctctgccgttgtagagaaccgcacggaagcgcccttcacgatc
gagcagatagcggcagggacatggaacctgccgcgtggaacagactatcgtctgcgctat
ctgactggccgctgggctggtgagtggagcctgcaggaacagcccgtgaatccgggcaag
gtagttctagagagtcggcgcggcactactggcgcgcagaacaacccatggtttgccatc
gatcgcagtggaagtgcggatcaggatgagggtggtgtctggttcggcgcactgggctgg
agcgggtcgtggcagatctctgtagagcaggatgccttgcagcaggtccgcatcacgggc
ggaccgaatgcctttgacttcggctatctcctcaagaaaggcgagcgctttcagacaccc
tgtttttatggtggctattcggcgcatggcataggcggagcctcgcgtttgctgcatcgc
tttgaggtgaattcactcctgccgcatcatcccgattctaagctgaggcctgtgctctat
aactcatgggaggcgacagggtttgacgtagatgaagcagggcagatgtctcttgcagag
aaggcagcgaagatcggtgtcgaacgctttgtcatggatgacggctggtttggtcagcgt
aagaacgatcatgcgggtttaggcgactggtatgtcaacccacaaaagtttccgcacgga
ttgaaaccgctgatcgataaagtccactccctgaagatggacttcggtctttgggttgag
cccgagatggtgaaccccgatagcgatctctatcgcaaacacccggattgggtacttgaa
tttcccgggcgtccccatacagaggcacgtcaccaactggtgttgaatcttgcgcggcct
gatgtgcgcgcttatgtgtatggattcctcgataagttacttaaggaaaacgatatttct
tttctcaaatgggattacaaccgtaactggtccgaacctggctggcctgcggtccctcaa
gaacaagagaagaatgtttatatcgattttattcgcaactattattcgatcctcgatgaa
ctaaggcacgaacatccgaaggtagagattgagtcctgttccggtggtggcagtcgggtg
gatctgggagtgatgcaatataccgatgaggtgtggccttcagataatacggatgcctat
gaccggctgctgatccagaacggttttacttacgcctacactcccgcaacgatgatggcg
tgggttacagattcgccgaactgggtcaacaaccgtgcgctttcgctggaatatcgtttc
ctgtcctcgatgcagggttcgcttgggattggggcgaacctgaaccagtggaagccggaa
gatttcgctacagccaggcagatggtggaacgatataaatctattcgcgaaacggtgcag
agaggcgcgctctatcgccttctgactcctgagcataatagcgagcagtctataacggag
acggtctcgcgcgatggagatcaggcggtagtcttcgcttttcttcactccagccaggag
aactatccgtttcctcgaatcttcctgcgtggtctggatgagggagcgacttatagcatc
agcgcctttgcaggcaaattagcggagggaactccaacgcaggccagtggttcgtactgg
gaacaccacggtatcgatgtggatctgcatggagattttcaggcgatggccttcacgctg
aagcgtagtcgctag

DBGET integrated database retrieval system