KEGG   Granulicella mallensis: AciX8_0891Help
Entry
AciX8_0891        CDS       T01664                                 

Definition
ANTAR domain-containing protein with unknown sensor
Orthology
K01719  
uroporphyrinogen-III synthase [EC:4.2.1.75]
Organism
gma  Granulicella mallensis
Pathway
Porphyrin and chlorophyll metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Class
Metabolism; Metabolism of cofactors and vitamins; Porphyrin and chlorophyll metabolism [PATH:gma00860]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
complement(1052290..1053933)
Genome map
AA seq 547 aa AA seqDB search
MAHASFNGLRVLALESRRAKEVEKLILTYGGEPIVVPAMREVGLESNQHVLDFAAHLLEG
RFDLLIFMTGVGVRAMLEIVQTRYDREDFLAALRKIKIAVRGAKPNSALRELKINADVVS
EEPSTWHELLQAIDAAYGDALGDMRVAVQEYGASNPELLAELSSRTRELTKVPVYQWALP
EDLQPLRECVLGILSGSVDVVLFMTAVQAIHLFRVAEQMGVRNELREALGKAVVVSIGPT
TSEELTHYGLEPDFEPSRPKMGFMVNEAAQYSSGLLVKKRNGEMEAVASQPATEGETAPA
KRVRRVAVSTPTMAGFRDGLAEMDFLHEISSRIAAADSLHLVLDRIVDFISGVIPCDSCF
IYVLEGEQLMLRASKNPHAELIDHIGVQVGQGVTGWVAKHRQPVAIASAASNDPRFKAFK
NIPEDHFEAMLCTPILCAGRVVGVINLQHRMTYRHTTEQVRLLSTLGFLVGAEIERARLE
SENMQLTGRLETRKAVDRAKSVLQRDLSLNEEEAYQMMQRESRQRRKSMREIAEAILLAE
DFRRSTG
NT seq 1644 nt NT seq  +upstreamnt  +downstreamnt
ttggcacatgcaagcttcaatggacttcgggtactggcgctggaatcgcgtcgtgccaaa
gaggtcgagaagctgatcctcacctacggcggcgagccgatcgtcgtgcccgccatgcgt
gaggtgggcctcgagtcgaaccagcacgttctggattttgctgctcatctgctggaagga
cgcttcgacctcctcatcttcatgacgggtgtcggcgtgcgggcgatgctcgagatcgtg
caaacacgatacgaccgcgaagactttctggctgccctgcggaagataaagattgcagtg
cgtggggccaagccgaactcggcgctgcgcgaactgaagataaacgccgatgtcgtctcg
gaggaaccgagtacctggcatgagcttctgcaagccatcgatgcagcttatggcgatgct
ctgggagatatgcgcgtggccgtgcaggagtacggagcctccaatcccgaactgctcgcg
gagctcagcagccgcacccgcgagctgaccaaggtgccggtctatcaatgggcgctcccc
gaagacctgcaaccactgcgggagtgtgtgctcggcatcctgagcggatccgtcgatgtg
gtgctgttcatgacggccgtccaggctattcacctgtttcgcgtggcggagcagatgggc
gtccggaacgagttgcgcgaggcgctgggcaaggcggttgtggtctcgataggacctaca
acctccgaagagctcacccactacggcctcgagccggactttgaaccttcgcgccccaag
atgggcttcatggtcaacgaggcagcgcagtactcttcagggctgctggtaaagaagcga
aacggcgagatggaagcggtcgcatcgcagcctgcaacggaaggcgagactgcgcctgcc
aaacgagtgcgtcgcgtagcggtctccaccccgaccatggcgggctttcgcgatgggctt
gcggagatggactttctgcacgagatcagtagccgcatcgcggcggccgattctctgcat
ctcgtactcgatcgtatcgtcgactttatctccggcgtgatcccctgcgactcctgtttc
atctatgtgctcgaaggcgaacaactcatgctgcgtgcctctaagaatccgcacgcggag
cttatcgaccacatcggcgtccaggtaggacaaggcgtcacgggctgggttgcgaagcac
cggcaacctgtagcgattgcctctgcagcctccaacgatccccgcttcaaggccttcaag
aacattccggaagatcacttcgaagcgatgctttgcacgccaattctctgcgccggtcgc
gtggtcggcgttatcaaccttcagcaccgcatgacataccggcacaccaccgagcaggtc
aggcttctctctacgctggggtttctggtcggcgcggagatcgaacgcgccaggctggag
tcggagaacatgcagctcacggggaggctcgagacccgtaaggcggtagaccgcgcgaag
agcgtgctgcagcgcgatctatctctgaacgaagaagaagcctaccagatgatgcaacgc
gagagccgtcagcgccgcaagtccatgcgagagatcgccgaggcgattctcctggcggaa
gacttcaggcgatcgacaggatga

DBGET integrated database retrieval system