KEGG   Granulicella mallensis: AciX8_0936Help
Entry
AciX8_0936        CDS       T01664                                 

Definition
(GenBank) 6-phosphofructokinase
  KO
K21071  ATP-dependent phosphofructokinase / diphosphate-dependent phosphofructokinase [EC:2.7.1.11 2.7.1.90]
Organism
gma  Granulicella mallensis
Pathway
gma00010  Glycolysis / Gluconeogenesis
gma00030  Pentose phosphate pathway
gma00051  Fructose and mannose metabolism
gma00052  Galactose metabolism
gma00680  Methane metabolism
gma01100  Metabolic pathways
gma01110  Biosynthesis of secondary metabolites
gma01120  Microbial metabolism in diverse environments
gma01130  Biosynthesis of antibiotics
Brite
KEGG Orthology (KO) [BR:gma00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    AciX8_0936
   00030 Pentose phosphate pathway
    AciX8_0936
   00051 Fructose and mannose metabolism
    AciX8_0936
   00052 Galactose metabolism
    AciX8_0936
  Energy metabolism
   00680 Methane metabolism
    AciX8_0936
Enzymes [BR:gma01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.11  6-phosphofructokinase
     AciX8_0936
    2.7.1.90  diphosphate---fructose-6-phosphate 1-phosphotransferase
     AciX8_0936
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: PFK
Motif
Other DBs
NCBI-ProteinID: AEU35285
JGI: AciX8_0936
UniProt: G8NUC9
Position
1111436..1112635
Genome map
AA seq 399 aa AA seqDB search
MSAQNLLIIQGGGPTAVFNASLASIIKESFHQSRIGDIYGARAGMKGLSSADIVGLSHLG
PGDLLSLRNSPGAALGSSRFQPSELDLERSVEHLQRFGIQYLVFMGGNGTMRGADLFRRF
CREQNLDIQIIGIPKTIDNDISATDRCPGFASAARFVAQSTLDLSMDIRSLPQPVSIFET
LGRDVGWLAASSTLARRDADDAPHLVYIPETPFSLEAFLSDLDNVVSRIGWAVVVISEGV
QYADGSRVFEQKNASQYSSSNRPLIGGVAQYLSGVVADRLGIRCRSEKPGLIGRSCTAQV
SRRDLEDAELVGRTGVRALVAGETDKMVALCSLDVRSEQAFKLVPLSEAGGSHREIPADW
LSSDTLAVTNSFRDYLRPLVGELSYYPAPLSTLPRYEPV
NT seq 1200 nt NT seq  +upstreamnt  +downstreamnt
atgtctgctcaaaatctattgattatccagggaggtggccctactgctgtcttcaacgcc
agtcttgcgagcatcatcaaggaaagctttcaccaatctcgcattggggacatctacgga
gctcgagccggtatgaaaggcctatcctccgcggatattgtcggcttgagtcatctgggt
ccgggtgatcttttgtcgcttcggaacagtcctggggctgctctgggttcatcccgtttc
caaccatcggagctggacctcgaacgcagtgtcgagcacctgcagcgatttggtattcaa
tacctcgtctttatgggaggcaatggcaccatgaggggcgcggatctcttccgaagattc
tgccgggagcagaatttagacattcagatcatcgggattccaaagacgattgacaacgat
atctccgcgaccgatcgctgcccaggcttcgcgagcgcggctcggtttgtagcgcaatcc
acgctcgatctgagtatggatattcgttcgcttccgcaacccgtctcgatcttcgagact
ctgggccgggatgttggttggctggcggcgtcctcgacgcttgcgagacgcgatgcggac
gatgctccacacctcgtttatatcccggaaactccattctcactggaggcgttcttaagc
gatcttgacaacgtagtcagccggatcggctgggcggttgtcgtgatctccgaaggtgtc
cagtatgcggatggaagccgcgtctttgagcagaagaacgcttctcaatacagttcatcg
aatcgtccgttgattggcggtgtagcgcagtacttgtcgggtgttgtggcggatcgcctg
ggaatccgctgccgcagcgaaaagcccggactgatcggcagatcctgtacggcacaggtt
tccaggcgagacttggaggacgcggagctggttggccggacaggagttcgcgctttagtg
gccggtgaaaccgataagatggtggccctttgctcgcttgatgtccgatctgagcaggct
ttcaaactagtaccactgagcgaggccggagggtcgcatcgcgagattcccgcagactgg
ctcagcagcgatacgctggcggtaacaaattccttccgtgattacctccgcccgcttgta
ggcgaactctcttactatccggcaccactcagcaccctccctcgatatgagccggtgtag

DBGET integrated database retrieval system