KEGG   Granulicella mallensis: AciX8_0936Help
Entry
AciX8_0936        CDS       T01664                                 

Definition
6-phosphofructokinase
Orthology
K00850  
6-phosphofructokinase 1 [EC:2.7.1.11]
Organism
gma  Granulicella mallensis
Pathway
Glycolysis / Gluconeogenesis
Pentose phosphate pathway
Fructose and mannose metabolism
Galactose metabolism
Methane metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Carbon metabolism
Biosynthesis of amino acids
Module
Glycolysis (Embden-Meyerhof pathway), glucose => pyruvate
Brite
KEGG Orthology (KO) [BR:gma00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    AciX8_0936
   01230 Biosynthesis of amino acids
    AciX8_0936
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    AciX8_0936
   00030 Pentose phosphate pathway
    AciX8_0936
   00051 Fructose and mannose metabolism
    AciX8_0936
   00052 Galactose metabolism
    AciX8_0936
  Energy metabolism
   00680 Methane metabolism
    AciX8_0936
Enzymes [BR:gma01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.11  6-phosphofructokinase
     AciX8_0936
Protein phosphatases and associated proteins [BR:gma01009]
 Protein Ser/ Thr phosphatases
  Phosphoprotein phosphatases (PPPs)
   Protein phosphatase-1
    PP1-interacting proteins (PIPs)
     AciX8_0936
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
1111436..1112635
Genome map
AA seq 399 aa AA seqDB search
MSAQNLLIIQGGGPTAVFNASLASIIKESFHQSRIGDIYGARAGMKGLSSADIVGLSHLG
PGDLLSLRNSPGAALGSSRFQPSELDLERSVEHLQRFGIQYLVFMGGNGTMRGADLFRRF
CREQNLDIQIIGIPKTIDNDISATDRCPGFASAARFVAQSTLDLSMDIRSLPQPVSIFET
LGRDVGWLAASSTLARRDADDAPHLVYIPETPFSLEAFLSDLDNVVSRIGWAVVVISEGV
QYADGSRVFEQKNASQYSSSNRPLIGGVAQYLSGVVADRLGIRCRSEKPGLIGRSCTAQV
SRRDLEDAELVGRTGVRALVAGETDKMVALCSLDVRSEQAFKLVPLSEAGGSHREIPADW
LSSDTLAVTNSFRDYLRPLVGELSYYPAPLSTLPRYEPV
NT seq 1200 nt NT seq  +upstreamnt  +downstreamnt
atgtctgctcaaaatctattgattatccagggaggtggccctactgctgtcttcaacgcc
agtcttgcgagcatcatcaaggaaagctttcaccaatctcgcattggggacatctacgga
gctcgagccggtatgaaaggcctatcctccgcggatattgtcggcttgagtcatctgggt
ccgggtgatcttttgtcgcttcggaacagtcctggggctgctctgggttcatcccgtttc
caaccatcggagctggacctcgaacgcagtgtcgagcacctgcagcgatttggtattcaa
tacctcgtctttatgggaggcaatggcaccatgaggggcgcggatctcttccgaagattc
tgccgggagcagaatttagacattcagatcatcgggattccaaagacgattgacaacgat
atctccgcgaccgatcgctgcccaggcttcgcgagcgcggctcggtttgtagcgcaatcc
acgctcgatctgagtatggatattcgttcgcttccgcaacccgtctcgatcttcgagact
ctgggccgggatgttggttggctggcggcgtcctcgacgcttgcgagacgcgatgcggac
gatgctccacacctcgtttatatcccggaaactccattctcactggaggcgttcttaagc
gatcttgacaacgtagtcagccggatcggctgggcggttgtcgtgatctccgaaggtgtc
cagtatgcggatggaagccgcgtctttgagcagaagaacgcttctcaatacagttcatcg
aatcgtccgttgattggcggtgtagcgcagtacttgtcgggtgttgtggcggatcgcctg
ggaatccgctgccgcagcgaaaagcccggactgatcggcagatcctgtacggcacaggtt
tccaggcgagacttggaggacgcggagctggttggccggacaggagttcgcgctttagtg
gccggtgaaaccgataagatggtggccctttgctcgcttgatgtccgatctgagcaggct
ttcaaactagtaccactgagcgaggccggagggtcgcatcgcgagattcccgcagactgg
ctcagcagcgatacgctggcggtaacaaattccttccgtgattacctccgcccgcttgta
ggcgaactctcttactatccggcaccactcagcaccctccctcgatatgagccggtgtag

DBGET integrated database retrieval system