KEGG   Granulicella mallensis: AciX8_1010Help
Entry
AciX8_1010        CDS       T01664                                 

Definition
histidinol dehydrogenase
Orthology
K00013  
histidinol dehydrogenase [EC:1.1.1.23]
Organism
gma  Granulicella mallensis
Pathway
Histidine metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Biosynthesis of amino acids
Brite
KEGG Orthology (KO) [BR:gma00001]
 Metabolism
  Overview
   01230 Biosynthesis of amino acids
    AciX8_1010
  Amino acid metabolism
   00340 Histidine metabolism
    AciX8_1010
Enzymes [BR:gma01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.23  histidinol dehydrogenase
     AciX8_1010
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
complement(1203358..1204617)
Genome map
AA seq 419 aa AA seqDB search
MRVLKTFGENAKVAEDTLQQLEQRGAANTAKVDGVVREILAAVRERGDAALHEYTARFDG
LAAEQPLLVSREEMQSAWEATSEELKAAMRLAQANIRTFAEKQLPRAWSFRPSEGMEVGQ
IVRPLSSVGCYVPGGRYPLPSTLLMTVTPAQVAGVERIVVCSPKPARETMAAAYLAGVTE
FYRVGGAQAIAAMAFGTATIAAVDKIVGPGNLYVTAAKIAVSQETGIDMPAGPTEIVVTS
ENGDPSGIAADLVAQAEHDPEALAVLITSKHELAEEVALETKRQAQGNEIAQASLAAQGF
AFVTKTVEEAQALTNRLAPEHLTVDAGADLRWVKNAGSVFVGHHTPQSMGDYISGPNHVL
PTGRNGRVRGGLSVFDFVKVITVQQYTRDALREVGPHTIALAEAEGLAGHAESVRVRMR
NT seq 1260 nt NT seq  +upstreamnt  +downstreamnt
atgagagttttgaagacattcggcgagaacgcgaaggttgcagaggataccctccagcag
ctggaacagcgcggcgccgcaaacaccgcaaaggtggatggcgttgtgcgcgagattctc
gcagccgtgcgcgaacgcggcgatgctgcgctgcacgagtacacagctcgcttcgacggg
ctggccgccgaacagccgcttttggtcagccgcgaggagatgcagtccgcgtgggaggcc
acgagcgaagagctcaaagccgccatgcgcctggcgcaggccaacattcgcacgttcgcg
gagaaacaattgccgcgcgcgtggagctttcgcccctcagaggggatggaggtcgggcag
atcgtacggcctctgagttcggtcggctgctacgttccgggggggcgctatcccctgcct
tcaacgctgctgatgactgtgactccggcgcaggttgccggagtggaacgcatcgtggtg
tgctcgccgaagcccgcgcgggagacgatggccgccgcttatctcgcgggagtgacagag
ttctaccgcgtcggcggcgcgcaggcgattgcggcgatggccttcggcacggcgacgatt
gcagccgtagacaagatcgttgggccgggcaacctgtacgtgaccgcggcaaagattgcg
gtctcgcaggagaccggcatcgacatgcccgcggggccaaccgagattgtagtcaccagc
gagaacggcgaccccagcggcattgcggcggacctggtggcgcaggccgagcacgatccc
gaggcacttgctgtgctcatcaccagcaagcacgagttggccgaagaggtcgctctcgag
accaagcgccaggcgcagggcaatgagatcgcacaggcctcgctggcagcgcagggattt
gcattcgtcaccaagaccgtagaggaagctcaggcgctaacgaaccggctggctcctgaa
cacctgacggtagatgcgggcgccgatctgcgctgggtgaagaatgcgggttcagtgttt
gtgggacatcacacgccgcagtccatgggcgactacatcagcgggccaaaccatgtgctg
ccgacaggccgcaacggccgcgttcgcggcggcttgagcgtgttcgacttcgtaaaggtg
atcaccgtacagcagtacacgcgcgacgcgttgcgcgaggtcggcccgcacacgatcgcg
ctggccgaggcagaaggtctagcagggcacgccgagagcgtgcgcgtgaggatgcggtag

DBGET integrated database retrieval system