KEGG   Granulicella mallensis: AciX8_1179Help
Entry
AciX8_1179        CDS       T01664                                 

Definition
sigma-54 interacting domain-containing protein
Orthology
K03405  
magnesium chelatase subunit I [EC:6.6.1.1]
Organism
gma  Granulicella mallensis
Pathway
Porphyrin and chlorophyll metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:gma00001]
 Metabolism
  Metabolism of cofactors and vitamins
   00860 Porphyrin and chlorophyll metabolism
    AciX8_1179
Enzymes [BR:gma01000]
 6. Ligases
  6.6  Forming nitrogen-D-metal bonds
   6.6.1  Forming coordination complexes
    6.6.1.1  magnesium chelatase
     AciX8_1179
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
complement(1394885..1396447)
Genome map
AA seq 520 aa AA seqDB search
MPSTALPRTLGQLRTSAYTADRVSRSVKDELRDNLIARLREIAPGGPKEGESLFPGIVGY
DDTVVPQVVNALLSRHNFILLGLRGQAKSRILRSLTTLLDPFSPYVAGSELRDNPYAPLS
KFSRDLVASLGDDTPIAWMTPIERYVEKLATPDVTVADLIGDVDPIKAARSGHELGSELT
MHYGLLPRANRGIFAINEVPDLAGKIQVALFNIMQEGDVQIKGYPVRLELDVAIVFSANP
EDYTARGKIVTPLKDRIGSEIRTHYPESLDEAISITEQEAWTARTYAPSNDAIQRIEIPH
YIRQIVEQIAFVAREDKKVDKRSGVSQRLPISTMELVVSNAERRALIHGESLVVPRVGDI
FAALPGITGKIELEYEGEMRGSDNVIRELIRSSVANIFDSYFADTNTQQIEQWFNLGGAV
ELNDKQPAATVLAELQQIQGLFEKLTPFKITSKSQPEVAVSAAEFLLEGMTAHKRISRSE
ARKFSAGEKRKRNEEAANFAERKREQEREDAHNRTRRGFN
NT seq 1563 nt NT seq  +upstreamnt  +downstreamnt
atgccgtcgactgcacttccgcgcaccctgggtcaactccgcacctctgcttacaccgcc
gatcgcgtctcccgcagcgtcaaggacgagcttcgcgacaacctgattgcccgcctgcgc
gagatcgcccctgggggaccgaaggaaggggaatcgctcttccccggcatcgtcggctat
gacgacacggtcgttccgcaggtggtcaatgcgctgctctcgcggcataatttcatcctg
ctgggcctgcgcggccaggcgaagtcgcgcatcctgcgctcgctgacgacgctgctcgat
cccttcagcccctacgtcgctggctccgagctgcgcgacaacccctacgccccgctctcg
aagttctcgcgcgacctcgtcgcctcgctcggcgacgatacccccatcgcgtggatgact
ccgatcgagcgctacgtcgaaaagctcgcaactccggacgtgaccgtggccgacctcatc
ggcgacgtcgatccgatcaaagccgcgcgtagcggccacgagctcggcagcgagctgacc
atgcactacggtctgctgccccgggccaatcgcggaatcttcgccatcaacgaggtcccg
gacctcgccgggaagatccaggtcgccctcttcaacatcatgcaggaaggcgacgtacaa
attaagggctatccggtacgcctggaactcgatgtcgccatcgtcttctcggccaacccc
gaggactacacggcgcgcggcaagattgtcaccccgctcaaagaccgcatcggcagcgag
attcgcacgcactaccctgagtcgctcgacgaagccatcagcatcacggagcaggaggcc
tggacggcgcgcacctatgctccctccaacgacgccatccagcgcatcgagattccgcac
tacatccgtcagatcgtcgagcagatcgcttttgtcgcgcgtgaggataagaaggtcgac
aaacgctcgggcgtgtcgcagcgcctgccgatcagcacgatggagcttgtggtctcgaac
gccgaacgccgggctttgattcacggcgaatcgctcgtcgtccctcgggtcggcgatatc
ttcgccgctctgccgggcatcacgggcaagattgagctggagtacgaaggcgagatgcgc
ggttcggacaacgtcatccgcgagttgatccgcagctctgtcgccaacatcttcgacagc
tactttgccgataccaacacgcagcagatcgagcagtggttcaaccttggcggtgccgtg
gagttgaatgacaagcagcctgccgcaacggttctggcggaactccaacagatccagggc
ctcttcgagaagctgacgccgttcaagatcacctcgaagtcccagcctgaggtagccgtc
tcagcggcggagttcctgctcgaaggcatgaccgcgcataagcgcatctcgcgcagcgaa
gcccgcaagttcagcgccggtgaaaagcgcaagcgcaacgaagaggcagcgaacttcgca
gaacgcaagcgtgagcaggagcgggaagacgcccacaatcgcacacgacggggattcaac
tag

DBGET integrated database retrieval system